Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-psoB

Neosartorya fumigata (Aspergillus fumigatus) Alpha/beta hydrolase psoB

Comment
Pseurotin biosynthesis protein B. Alpha/beta hydrolase; part of the gene cluster that mediates the biosynthesis of pseurotin A, a competitive inhibitor of chitin synthase and an inducer of nerve-cell proliferation. FUS2 hydrolase family. Other strains: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100; CEA10 / CBS 144.89 / FGSC A1163; Z5) (Aspergillus fumigatus)


Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus Af293
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E > Aspergillus fumigatus Af293: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: EAL85114, XP_747152, EDP49156
3 UniProt : Q4WAZ8, B0YAW3, A0A0J5PK60
3 UniProt : Q4WAZ8, B0YAW3, A0A0J5PK60
3 Interpro : Q4WAZ8, B0YAW3, A0A0J5PK60
3 Prodom : Q4WAZ8, B0YAW3, A0A0J5PK60
3 Pfam : Q4WAZ8, B0YAW3, A0A0J5PK60
3 PIRSF : Q4WAZ8, B0YAW3, A0A0J5PK60
3 SUPERFAM : Q4WAZ8, B0YAW3, A0A0J5PK60
Sequence
Graphical view for this peptide sequence: aspfu-psoB
Colored MSA for Duf_1100-S (raw)
MATIHKLFKSPFFDFEFLRLLAMAPYEGAEIGEVLEAAAKIKDQDPESWY
STLLETGGKAEAIAKQAEASGDRVGARRAYLRSSNYLRAAQFMLNEGPIG
HDERVLPTLERAIANFRKGVQYRDGKTIFLEIPYEGGKTLPGYLYLPPAA
RRIPGRKIPILLNSGGGDSTQEEIYFVNPAYGPDLGYAVLTFEGPGQGIV
LRRDKLPMRPDWESVTGPVLDHLFDLATRHPELELDLDHIAVTGASMGGY
FALRAAADPRIKACVSVDGFYSLSSFVGGRMPGPLFNGFMSGWLSDWMFN
GILGVLKKLAFQARWEFNHLRWATGSTTDADVMRSFGAYTLQKADGTEYL
ADVKCPTLVTGAGASFYFDPATTTDKIYDCLTSLQDGVDKEKWIATDVAY
GGLQAKIGAFGYSAQKTFEWLDQRFGIQREPLAASSRLEDLVSRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATIHKLFKSPFFDFEFLRLLAMAPYEGAEIGEVLEAAAKIKDQDPESWY
STLLETGGKAEAIAKQAEASGDRVGARRAYLRSSNYLRAAQFMLNEGPIG
HDERVLPTLERAIANFRKGVQYRDGKTIFLEIPYEGGKTLPGYLYLPPAA
RRIPGRKIPILLNSGGGDSTQEEIYFVNPAYGPDLGYAVLTFEGPGQGIV
LRRDKLPMRPDWESVTGPVLDHLFDLATRHPELELDLDHIAVTGASMGGY
FALRAAADPRIKACVSVDGFYSLSSFVGGRMPGPLFNGFMSGWLSDWMFN
GILGVLKKLAFQARWEFNHLRWATGSTTDADVMRSFGAYTLQKADGTEYL
ADVKCPTLVTGAGASFYFDPATTTDKIYDCLTSLQDGVDKEKWIATDVAY
GGLQAKIGAFGYSAQKTFEWLDQRFGIQREPLAASSRLEDLVSRL


References
2 more
    Title: Chemical and Genetic Studies on the Formation of Pyrrolones During the Biosynthesis of Cytochalasans
    Zhang H, Hantke V, Bruhnke P, Skellam E, Cox RJ
    Ref: Chemistry, 10:3106, 2021 : PubMed

            

    Title: Investigating the Function of Cryptic Cytochalasan Cytochrome P450 Monooxygenases Using Combinatorial Biosynthesis
    Wang C, Becker K, Pfutze S, Kuhnert E, Stadler M, Cox RJ, Skellam E
    Ref: Org Lett, 21:8756, 2019 : PubMed

            

    Title: Heterologous expression of the avirulence gene ACE1 from the fungal rice pathogen Magnaporthe oryzae
    Song Z, Bakeer W, Marshall JW, Yakasai AA, Khalid RM, Collemare J, Skellam E, Tharreau D, Lebrun MH and Cox RJ <3 more author(s)>
    Ref: Chem Sci, 6:4837, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer