Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-q4wim6

Aspergillus fumigatus: Aspergillus Neosartorya fumigata ef-hand domain protein

Comment
Other strains: Aspergillus fumigatus Af293: Aspergillus Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163)


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus Af293
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E > Aspergillus fumigatus Af293: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAHF01000008
1 UniProt : Q4WIM6
3 UniProt : Q4WIM6, B0XT86, A0A229XUQ7
3 Interpro : Q4WIM6, B0XT86, A0A229XUQ7
3 Prodom : Q4WIM6, B0XT86, A0A229XUQ7
3 Pfam : Q4WIM6, B0XT86, A0A229XUQ7
3 PIRSF : Q4WIM6, B0XT86, A0A229XUQ7
3 SUPERFAM : Q4WIM6, B0XT86, A0A229XUQ7
Sequence
Graphical view for this peptide sequence: aspfu-q4wim6
Colored MSA for FSH1 (raw)
MKVLCLHGKGTSGAIFKSQTDGCYPSTAAAGIDLFYPAPYYSFWEDDSPE
AITKTCTWLKGLIAERGPYDAVMMFSQGCALGTAMLLLHQAQDPTQPPPF
KAAIFICGGPPLKLLESIGFEVSDAVKERDRAGREALATQAHSASILARG
SARWMGDASRGGAVDEEELRGAIRGPFTVGVPTVHVYGSKDPRYAAGVQL
SGICEPGKRRVFDHGGGHEIPRTDRVSRTIAELVRWVLLEASA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVLCLHGKGTSGAIFKSQTDGCYPSTAAAGIDLFYPAPYYSFWEDDSPE
AITKTCTWLKGLIAERGPYDAVMMFSQGCALGTAMLLLHQAQDPTQPPPF
KAAIFICGGPPLKLLESIGFEVSDAVKERDRAGREALATQAHSASILARG
SARWMGDASRGGAVDEEELRGAIRGPFTVGVPTVHVYGSKDPRYAAGVQL
SGICEPGKRRVFDHGGGHEIPRTDRVSRTIAELVRWVLLEASA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer