aspfu-q4x1n0

 
Aspergillus fumigatus (Sartorya fumigata), Neosartorya fischeri (Aspergillus fischerianus), probable cutinase 1 precursor (EC 3.1.1.74) Cut1 (cutin hydrolase 1) McCut

Comment
Other strains: Aspergillus fumigatus (Sartorya fumigata) (and CEA10/CBS 144.89/FGSC A1163and Neosartorya fischeri (strain ATCC 1020/DSM 3700/FGSC A1164/NRR181) (Aspergillus fischerianus) . Best pNP substrate pNP-C4 Paranitrophenylbutyrate


Relationship
Family Cutinase
Block X
Aspergillus fumigatus Af293 position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E > Aspergillus fumigatus Af293: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Paranitrophenylbutyrate ,

>3 Genbank links 1 more: AAHF01000001, DS499595, DS027696
3 UniProt : Q4X1N0, B0XRY3, A1DGN0
3 UniProtTrembl : Q4X1N0, B0XRY3, A1DGN0
3 Interpro : Q4X1N0, B0XRY3, A1DGN0
3 Prodom : Q4X1N0, B0XRY3, A1DGN0
3 Pfam : Q4X1N0, B0XRY3, A1DGN0
3 PIRSF : Q4X1N0, B0XRY3, A1DGN0
3 SUPERFAM : Q4X1N0, B0XRY3, A1DGN0
3 QuickSwissBlast : Q4X1N0, B0XRY3, A1DGN0
 
Sequence
Graphical view for this peptide sequence: aspfu-q4x1n0
Colored MSA for Cutinase (raw)
MKFALLSLAAMAVASPVAIDVRQTAITGDELRTGPCEPITFIFARGSTEP
GLLGITTGPGVCNALKLSRPGQVACQGVGPAYIADLASNFLPQGTSQVAI
DEAAGLFKLAASKCPDTKIVAGGYSQGAAVMHGAIRNLPSNVQNMIKGVV
LFGDTRNKQDGGRIPNFPTDRTKIYCAFGDLVCDGTLIITPAHLSYGDDV
PSATSFLLSKV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFALLSLAAMAVASPVAIDVRQTAITGDELRTGPCEPITFIFARGSTEP
GLLGITTGPGVCNALKLSRPGQVACQGVGPAYIADLASNFLPQGTSQVAI
DEAAGLFKLAASKCPDTKIVAGGYSQGAAVMHGAIRNLPSNVQNMIKGVV
LFGDTRNKQDGGRIPNFPTDRTKIYCAFGDLVCDGTLIITPAHLSYGDDV
PSATSFLLSKV

no DNA




References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            

    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer