aspfu-q5vjg7

 
Neosartorya fumigata (Aspergillus fumigatus), Neosartorya fischeri (Aspergillus fischerianus) carboxypeptidase 5

Comment
Other strains: Neosartorya fumigata (strains CEA10 / CBS 144.89 / FGSC A1163; ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus); Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus) Aspergillus fumigatus Af293


Relationship
Block X
Aspergillus fumigatus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AY436355, AAHF01000008
>3 UniProt links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 UniProtTrembl links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 Interpro links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 Prodom links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 Pfam links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 PIRSF links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 SUPERFAM links 3 more: Q5VJG7, B2CPP3, A1CZ48
>3 QuickSwissBlast links 3 more: Q5VJG7, B2CPP3, A1CZ48
 
Sequence
Graphical view for this peptide sequence: aspfu-q5vjg7
Colored MSA for Carboxypeptidase_S10 (raw)
MLFGSVASTALLALSLCLDSASAAKHGRFGQKARDSLAKRSSSSLVTHEP
ETRSRHKDFRFLNKDTKPYLVKSLPDVKFDIGEMYSGSVPIDKGNKSREL
FFIFQPTIGEPVDEVTIWLNGGPGCSSLEGFFQENGRFTWQPGTLAPVEN
PYSWVNLTNMLWVDQPVGTGFATGKPTATSQEEIAEDFIKFFKNFQEIFG
IKNYKIYVTGESYAGRYVPYISAAMLDQNDTEYYDLKGALVYDPCIGQFD
YVQEEVPAVPFVQQNANLFNFNASFMAELERLHQTCGYQDFIDKYLVFPP
SGVQPPKMFNYTSDAECDVFDMIKTAAMAVNPCFDIYEINLMCPLAWDVL
AFPTELVYQPAGATVYFDREDVKRALHAPSIKWAECADEAVFVGGSGGPE
QEGDFSANPIEHVLPQVIEATNRVLVSNGDYDMIILTNGTLLAIQNMTWH
GQLGFQSAPSTPITITLPDLHYADVYAENQMTGVDGAQGVMGVQHYERGL
MWAETYQSGHMQPQYQPRVTYRHLQWLLGHIESL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLFGSVASTALLALSLCLDSASAAKHGRFGQKARDSLAKRSSSSLVTHEP
ETRSRHKDFRFLNKDTKPYLVKSLPDVKFDIGEMYSGSVPIDKGNKSREL
FFIFQPTIGEPVDEVTIWLNGGPGCSSLEGFFQENGRFTWQPGTLAPVEN
PYSWVNLTNMLWVDQPVGTGFATGKPTATSQEEIAEDFIKFFKNFQEIFG
IKNYKIYVTGESYAGRYVPYISAAMLDQNDTEYYDLKGALVYDPCIGQFD
YVQEEVPAVPFVQQNANLFNFNASFMAELERLHQTCGYQDFIDKYLVFPP
SGVQPPKMFNYTSDAECDVFDMIKTAAMAVNPCFDIYEINLMCPLAWDVL
AFPTELVYQPAGATVYFDREDVKRALHAPSIKWAECADEAVFVGGSGGPE
QEGDFSANPIEHVLPQVIEATNRVLVSNGDYDMIILTNGTLLAIQNMTWH
GQLGFQSAPSTPITITLPDLHYADVYAENQMTGVDGAQGVMGVQHYERGL
MWAETYQSGHMQPQYQPRVTYRHLQWLLGHIESL

no DNA




References
    Title: Discovery of a sexual cycle in the opportunistic fungal pathogen Aspergillus fumigatus
    O'Gorman CM, Fuller H, Dyer PS
    Ref: Nature, 457:471, 2009 : PubMed

            

    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer