Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspnc-a5abe8

Aspergillus niger Aspergillus kawachii similar to pnb Carboxylesterase(EC 3.1.1.-)

Comment
Other strains: (strains CBS 513.88 / FGSC A1513; ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH / Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillu awamori var. kawachi)


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AM270218, ACJE01000019, DF126450
2 UniProt : A5ABE8, G3YBD8
3 UniProt : A5ABE8, G3YBD8, G7X9W0
3 Interpro : A5ABE8, G3YBD8, G7X9W0
3 Prodom : A5ABE8, G3YBD8, G7X9W0
3 Pfam : A5ABE8, G3YBD8, G7X9W0
3 PIRSF : A5ABE8, G3YBD8, G7X9W0
3 SUPERFAM : A5ABE8, G3YBD8, G7X9W0
Sequence
Graphical view for this peptide sequence: aspnc-a5abe8
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MSDQVVVIVPTQTSPSHPQRVIGRKSPISGIEEFRGIPYGTVPARWQHAV
LRDRLPQDEFDATRNGPLTPRPEPNNTDEYQSHLEFPADVTESEFDCLNL
FITRPSAAALAAAGFDVQEVKLPVYVYIHGGAYSFGAGTDPIWDPARLVK
KSVELGTPMIVATINYRLNMFGFAASSEIIQAQPEGQRKGCNFGLSDQRT
AIRWVRQNIGAFGGDATQITVGGQSAGGSSSHAHVLEAVLGKGEPLVQRG
IIQSGTLGVLGPISMDVSNARWNAFCQHAGAPAGDAISRMAFMVKLPPAE
ILQAAGKLGSIVCPLVEDGLTISKRPNGRWNVHLDGLQSEPIAETSASGA
GVIPVLIGDTDVEGLLHLNVVNGIRNYEHLSEQLSAGVESKEFLEDLYQA
YGFEPDTPPAELRKRVLQLLTDIQFGYPVQCARQELRDWEVPRDKLTESP
TITRSTAVHSYRMSVGNPFPGPRQGIAQHCVDLIYIYDCFADALRVADEA
LPAKAPTNAALVDRVQENWIRFITAPSLDSQAGNATVYGSDRTTSTIHMD
SDRTWTDRMHRFHILGRHWRSAQQAMQAITGPSHIL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDQVVVIVPTQTSPSHPQRVIGRKSPISGIEEFRGIPYGTVPARWQHAV
LRDRLPQDEFDATRNGPLTPRPEPNNTDEYQSHLEFPADVTESEFDCLNL
FITRPSAAALAAAGFDVQEVKLPVYVYIHGGAYSFGAGTDPIWDPARLVK
KSVELGTPMIVATINYRLNMFGFAASSEIIQAQPEGQRKGCNFGLSDQRT
AIRWVRQNIGAFGGDATQITVGGQSAGGSSSHAHVLEAVLGKGEPLVQRG
IIQSGTLGVLGPISMDVSNARWNAFCQHAGAPAGDAISRMAFMVKLPPAE
ILQAAGKLGSIVCPLVEDGLTISKRPNGRWNVHLDGLQSEPIAETSASGA
GVIPVLIGDTDVEGLLHLNVVNGIRNYEHLSEQLSAGVESKEFLEDLYQA
YGFEPDTPPAELRKRVLQLLTDIQFGYPVQCARQELRDWEVPRDKLTESP
TITRSTAVHSYRMSVGNPFPGPRQGIAQHCVDLIYIYDCFADALRVADEA
LPAKAPTNAALVDRVQENWIRFITAPSLDSQAGNATVYGSDRTTSTIHMD
SDRTWTDRMHRFHILGRHWRSAQQAMQAITGPSHIL


References
1 more
    Title: Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88
    Andersen MR, Salazar MP, Schaap PJ, van de Vondervoort PJ, Culley D, Thykaer J, Frisvad JC, Nielsen KF, Albang R and Baker SE <37 more author(s)>
    Ref: Genome Res, 21:885, 2011 : PubMed

            

    Title: Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88
    Pel HJ, de Winde JH, Archer DB, Dyer PS, Hofmann G, Schaap PJ, Turner G, de Vries RP, Albang R and Stam H <59 more author(s)>
    Ref: Nat Biotechnol, 25:221, 2007 : PubMed

            

    Title: Cloning and characterization of avfA and omtB genes involved in aflatoxin biosynthesis in three Aspergillus species
    Yu J, Woloshuk CP, Bhatnagar D, Cleveland TE
    Ref: Gene, 248:157, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer