Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspnc-pyni

Aspergillus niger (strain CBS 513.88 / FGSC A1513). Pyranonigrin biosynthesis cluster protein I

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM270218
1 UniProt : A5ABG7
1 UniProt : A5ABG7
1 Interpro : A5ABG7
1 Prodom : A5ABG7
1 Pfam : A5ABG7
1 PIRSF : A5ABG7
1 SUPERFAM : A5ABG7
Sequence
Graphical view for this peptide sequence: aspnc-pyni
Colored MSA for Thioesterase (raw)
MEPILHIQGDAHSSLTPLIFIHAVSGLAWPYMALGNLSNTSDPARSRPVY
GISSPVYSSELQPHGPYLLGGWSMGGMIAVKMAEILQAKKETVQQVILLD
SINPEKYPAFVNEEEHRIIADGLFTNVCQAMGMADLADDSDDEDNRSDAS
DASDDGSTMSDEEEEDDNLHRLFSTMRRHIHASTLSISSTEPGKLLPPNS
VCHTSVTLVKCTQLSETVPALFSARQRCIRRCALHPTLQWRPQNFDRFRT
LLIDARHDSLFDEEHVEEVTSMLRQILESC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEPILHIQGDAHSSLTPLIFIHAVSGLAWPYMALGNLSNTSDPARSRPVY
GISSPVYSSELQPHGPYLLGGWSMGGMIAVKMAEILQAKKETVQQVILLD
SINPEKYPAFVNEEEHRIIADGLFTNVCQAMGMADLADDSDDEDNRSDAS
DASDDGSTMSDEEEEDDNLHRLFSTMRRHIHASTLSISSTEPGKLLPPNS
VCHTSVTLVKCTQLSETVPALFSARQRCIRRCALHPTLQWRPQNFDRFRT
LLIDARHDSLFDEEHVEEVTSMLRQILESC


References
    Title: Elucidation of Pyranonigrin Biosynthetic Pathway Reveals a Mode of Tetramic Acid, Fused gamma-Pyrone, and exo-Methylene Formation
    Yamamoto T, Tsunematsu Y, Noguchi H, Hotta K, Watanabe K
    Ref: Org Lett, 17:4992, 2015 : PubMed

            

    Title: Pyranonigrin E: a PKS-NRPS hybrid metabolite from Aspergillus niger identified by genome mining
    Awakawa T, Yang XL, Wakimoto T, Abe I
    Ref: Chembiochem, 14:2095, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer