Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspni-EstA

Aspergillus niger Aspergillus kawachii Carboxylesterase EstA (EC 3.1.1.3) (ec 3.1.1.41)

Comment
aspni-EstA is an esterase. The L1 loop is 26 residues shorter than the structurally equivalent lid-forming loop of GCL (geoca-2lipa) and 11 residues shorter than the equivalent loop in AChE Other strains: (strains CBS 513.88 / FGSC A1513; ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH / Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1UKC: Crystal Structure of Aspergillus niger EstA
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AY456379, AM270300, ACJE01000003
>3 UniProt links 1 more: Q6ED33, A2R1N7, G3XQ16
1 Structure : 1UKC
>3 UniProt links 1 more: Q6ED33, A2R1N7, G3XQ16
>3 Interpro links 1 more: Q6ED33, A2R1N7, G3XQ16
>3 Pfam links 1 more: Q6ED33, A2R1N7, G3XQ16
>3 PIRSF links 1 more: Q6ED33, A2R1N7, G3XQ16
>3 SUPERFAM links 1 more: Q6ED33, A2R1N7, G3XQ16
Sequence
Graphical view for this peptide sequence: aspni-EstA
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MLHLVCLALLCHVARGLPTQASHNAQPVINLGYARYQGVRLEAGVDEFLG
MRYASPPIGDLRFRAPQDPPANQTLQSATEYGPICIGLDEEQSPGDISED
CLFINVFKPSTATSQSKLPVWLFIQGGGYAENSNANYNGTQVIQASDDVI
VFVTFNYRVGALGFLASEKVRQNGDLNAGLLDQRKALRWVKQYIEQFGGD
PDHIVIHGVSAGAGSVAYHLSAYGGKDEGLFIGAIVESSFWPTQRTVSEM
EFQFERFVNDTGCSSARDSLECLREQDIATIQKGNTGSPFPGGSSSPLPD
WYFLPVTDGSLVPDELYNAFDAGNFIKVPVLVGDDTDEGSNFAYNASSSA
DVSRFFKNNYPNLTSQQLNEINQVYPRGKLLPRHAAYFGASSAAYGDATF
TCPGNHVASSAARYLPNSVWNYRVNIIDESNIAGGIGVPHTFELPAIFGA
GSTGTLSSSSSYLTYNAAIIPVTMHYFISFVQTLNPNTYRYATAPEWNTW
GNGQRLRLQTNDTAMEAVPESSLQDCAFWKSLTVPMEV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLHLVCLALLCHVARGLPTQASHNAQPVINLGYARYQGVRLEAGVDEFLG
MRYASPPIGDLRFRAPQDPPANQTLQSATEYGPICIGLDEEQSPGDISED
CLFINVFKPSTATSQSKLPVWLFIQGGGYAENSNANYNGTQVIQASDDVI
VFVTFNYRVGALGFLASEKVRQNGDLNAGLLDQRKALRWVKQYIEQFGGD
PDHIVIHGVSAGAGSVAYHLSAYGGKDEGLFIGAIVESSFWPTQRTVSEM
EFQFERFVNDTGCSSARDSLECLREQDIATIQKGNTGSPFPGGSSSPLPD
WYFLPVTDGSLVPDELYNAFDAGNFIKVPVLVGDDTDEGSNFAYNASSSA
DVSRFFKNNYPNLTSQQLNEINQVYPRGKLLPRHAAYFGASSAAYGDATF
TCPGNHVASSAARYLPNSVWNYRVNIIDESNIAGGIGVPHTFELPAIFGA
GSTGTLSSSSSYLTYNAAIIPVTMHYFISFVQTLNPNTYRYATAPEWNTW
GNGQRLRLQTNDTAMEAVPESSLQDCAFWKSLTVPMEV


References
3 more
    Title: A. niger protein EstA, perhaps a new electrotactin, defines a new class of fungal esterases within the alpha/beta hydrolase fold superfamily
    Bourne Y, Hasper AA, Chahinian H, Renault L, Juin M, De Graaff LH, Marchot P
    Ref: Chemico-Biological Interactions, 157-158:395, 2005 : PubMed

            

    Title: Aspergillus niger protein EstA defines a new class of fungal esterases within the alpha/beta hydrolase fold superfamily of proteins
    Bourne Y, Hasper AA, Chahinian H, Juin M, De Graaff LH, Marchot P
    Ref: Structure, 12:677, 2004 : PubMed

            

    Title: Defining substrate characteristics from 3D structure; perspective on EstA structure
    Schrag JD, Cygler M
    Ref: Structure, 12:521, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer