Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspni-hyl1

Aspergillus niger hyl1 gene, exons 1-9

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 1QO7, 3G02, 3G0I
No kinetic





1 substrate:
Glycidyl-phenyl-ether
1 inhbitor:
Valpromide
3 Genbank : AJ238459, 238460, AJ238460
3 Structure : 1QO7, 3G02, 3G0I
1 UniProt : Q9UR30
1 Interpro : Q9UR30
1 Prodom : Q9UR30
1 Pfam : Q9UR30
1 PIRSF : Q9UR30
1 SUPERFAM : Q9UR30
Sequence
Graphical view for this peptide sequence: aspni-hyl1
Colored MSA for Epoxide_hydrolase (raw)
MSAPFAKFPSSASISPNPFTVSIPDEQLDDLKTLVRLSKIAPPTYESLQA
DGRFGITSEWLTTMREKWLSEFDWRPFEARLNSFPQFTTEIEGLTIHFAA
LFSEREDAVPIALLHGWPGSFVEFYPILQLFREEYTPETLPFHLVVPSLP
GYTFSSGPPLDKDFGLMDNARVVDQLMKDLGFGSGYIIQGGDIGSFVGRL
LGVGFDACKAVHLNLCAMRAPPEGPSIESLSAAEKEGIARMEKFMTDGLA
YAMEHSTRPSTIGHVLSSSPIALLAWIGEKYLQWVDKPLPSETILEMVSL
YWLTESFPRAIHTYRETTPTASAPNGATMLQKELYIHKPFGFSFFPKDLC
PVPRSWIATTGNLVFFRDHAEGGHFAALERPRELKTDLTAFVEQVWQK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSAPFAKFPSSASISPNPFTVSIPDEQLDDLKTLVRLSKIAPPTYESLQA
DGRFGITSEWLTTMREKWLSEFDWRPFEARLNSFPQFTTEIEGLTIHFAA
LFSEREDAVPIALLHGWPGSFVEFYPILQLFREEYTPETLPFHLVVPSLP
GYTFSSGPPLDKDFGLMDNARVVDQLMKDLGFGSGYIIQGGDIGSFVGRL
LGVGFDACKAVHLNLCAMRAPPEGPSIESLSAAEKEGIARMEKFMTDGLA
YAMEHSTRPSTIGHVLSSSPIALLAWIGEKYLQWVDKPLPSETILEMVSL
YWLTESFPRAIHTYRETTPTASAPNGATMLQKELYIHKPFGFSFFPKDLC
PVPRSWIATTGNLVFFRDHAEGGHFAALERPRELKTDLTAFVEQVWQK


References
3 more
    Title: Directed evolution of an enantioselective epoxide hydrolase: uncovering the source of enantioselectivity at each evolutionary stage
    Reetz MT, Bocola M, Wang LW, Sanchis J, Cronin A, Arand M, Zou J, Archelas A, Bottalla AL and Mowbray SL <1 more author(s)>
    Ref: Journal of the American Chemical Society, 131:7334, 2009 : PubMed

            

    Title: Structure of Aspergillus niger epoxide hydrolase at 1.8 A resolution: implications for the structure and function of the mammalian microsomal class of epoxide hydrolases
    Zou J, Hallberg BM, Bergfors T, Oesch F, Arand M, Mowbray SL, Jones TA
    Ref: Structure Fold Des, 8:111, 2000 : PubMed

            

    Title: Cloning and molecular characterization of a soluble epoxide hydrolase from Aspergillus niger that is related to mammalian microsomal epoxide hydrolase
    Arand M, Hemmer H, Durk H, Baratti J, Archelas A, Furstoss R, Oesch F
    Ref: Biochemical Journal, 344:273, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer