Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspor-PKSL1

Aspergillus oryzae and Aspergillus sp. L Aspergillus flavus Aspergillus parasiticus aflatoxin biosynthesis pksa polyketide synthase

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Aspergillus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3ILS: The PksA Thioesterase Domain (3ILS replaced 3D4H withdrawned)
No kinetic





No Substrate
No inhibitor
>3 Genbank links 6 more: AY510452, L42766, L42765
>3 UniProt links 3 more: Q5VDF2, Q71MJ1, Q5VDA4
1 Structure : 3ILS
>3 UniProt links 4 more: Q8J1K8, Q5VDF2, Q71MJ1
>3 Interpro links 4 more: Q8J1K8, Q5VDF2, Q71MJ1
>3 Prodom links 4 more: Q8J1K8, Q5VDF2, Q71MJ1
>3 Pfam links 4 more: Q8J1K8, Q5VDF2, Q71MJ1
>3 PIRSF links 4 more: Q8J1K8, Q5VDF2, Q71MJ1
>3 SUPERFAM links 4 more: Q8J1K8, Q5VDF2, Q71MJ1
Sequence
Graphical view for this peptide sequence: aspor-PKSL1
Colored MSA for Thioesterase (raw)
ANTQVSSQAIPAEATHSHTPPQPKHSPVPETAGSAPAAKGVGVSNEKLDA
VMRVVSEESGIALEELTDDSNFADMGIDSLSSMVIGSRFREDLGLDLGPE
FSLFIDCTTVRALKDFMLGSGDAGSGSNVEDPPPSATPGINPEIDWSSSA
SDSIFASEDHDHSSESGADTGSPPALDLKPYCRPSTSVVLQGLPMVARKT
LFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIES
FCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPI
PQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLILHFIAVVDVM
LDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPD
GWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ANTQVSSQAIPAEATHSHTPPQPKHSPVPETAGSAPAAKGVGVSNEKLDA
VMRVVSEESGIALEELTDDSNFADMGIDSLSSMVIGSRFREDLGLDLGPE
FSLFIDCTTVRALKDFMLGSGDAGSGSNVEDPPPSATPGINPEIDWSSSA
SDSIFASEDHDHSSESGADTGSPPALDLKPYCRPSTSVVLQGLPMVARKT
LFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIES
FCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPI
PQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLILHFIAVVDVM
LDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPD
GWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA


References
7 more
    Title: Aflatoxin biosynthesis cluster gene cypA is required for G aflatoxin formation
    Ehrlich KC, Chang PK, Yu J, Cotty PJ
    Ref: Applied Environmental Microbiology, 70:6518, 2004 : PubMed

            

    Title: Variability in nitrogen regulation of aflatoxin production by Aspergillus flavus strains
    Ehrlich KC, Cotty PJ
    Ref: Applied Microbiology & Biotechnology, 60:174, 2002 : PubMed

            

    Title: Characterization of the polyketide synthase gene (pksL1) required for aflatoxin biosynthesis in Aspergillus parasiticus
    Feng GH, Leonard TJ
    Ref: Journal of Bacteriology, 177:6246, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer