Gene_locus Report for: aspor-Q9Y8E3

Aspergillus oryzae Aspergillus flavus (strain ATCC 200026/FGSC A1120/NRRL 3357/ JC12722 / SRRC 167) alanyl dipeptidyl peptidase

Relationship

Family	\|	Prolyl_oligopeptidase_S9
Block	\|	X
Position in NCBI Life Tree	\|	Aspergillus oryzae

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E

There are 198 a/b hydrolases in Aspergillus oryzae view in a: Table

6_AlphaBeta_hydrolase : aspor-q2twv4Aspergillus oryzae; Aspergillus flavus Predicted protein, aspor-q2tyv8Aspergillus oryzae (strain ATCC 42149 / RIB 40) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) Predicted protein, aspor-q2tzv9Aspergillus oryzae predicted protein, aspor-q2u1a5Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2u1k0Aspergillus oryzae predicted protein, aspor-q2u1k8Aspergillus oryzae rib40 genomic dna, sc138, aspor-q2u5y8Aspergillus oryzae predicted protein, aspor-q2u704Aspergillus oryzae predicted protein, aspor-q2uak9Aspergillus oryzae predicted protein, aspor-q2uaq4Aspergillus oryzae (strain ATCC 42149 / RIB 40) Predicted protein, aspor-q2ubm2Aspergillus oryzae predicted protein, aspor-q2ubr2Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2uef3Aspergillus oryzae predicted protein, aspor-q2ufr3Aspergillus oryzae (strain ATCC 42149 / RIB 40) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) Predicted protein, aspor-q2uhf0Aspergillus oryzae (strain ATCC 42149 / RIB 40) Predicted protein, aspor-q2uhj6Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2uiy5Aspergillus oryzae (strain ATCC 42149 / RIB 40) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) Predicted protein, aspor-q2upl1Aspergillus oryzae predicted protein, aspor-q2uta5Aspergillus oryzae (strain ATCC 42149 / RIB 40) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) Predicted protein, aspor-q2uu89Aspergillus oryzae predicted protein, aspor-q2uub4Aspergillus oryzae Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) predicted protein.
A85-EsteraseD-FGH : aspor-q2usv6Aspergillus oryzae Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) esterase d.
A85-IroE-IroD-Fes-Yiel : aspor-q2u8r1Aspergillus oryzae Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) Siderophore esterase IroE-like.
ABHD11-Acetyl_transferase : aspor-q2uib5Aspergillus oryzae predicted alpha/beta hydrolase, aspor-q2ure7Aspergillus oryzae (strain ATCC 42149 / RIB 40) predicted alpha/beta hydrolase.
ABHD13-BEM46 : aspoz-a0a1s9dwr5Aspergillus oryzae (Yellow koji mold); Aspergillus flavus. Hydrolase_4 domain-containing protein.
Acidic_Lipase : aspor-q2u453Aspergillus oryzae, Aspergillus flavus triglyceride lipase-cholesterol esterase.
AlphaBeta_hydrolase : aspor-q2u144Aspergillus oryzae predicted protein, aspor-q2u161Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2u348Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2uba1Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2uiz4Aspergillus oryzae predicted protein.
Arb2_domain : aspor-q2uj83Aspergillus oryzae (Yellow koji mold); Aspergillus flavus; Aspergillus parasiticus; Aspergillus arachidicola. Uncharacterized protein.
Bacterial_esterase : aspor-q2u185Aspergillus oryzae predicted protein.
Canar_LipB : aspor-q2ue03Aspergillus oryzae (Yellow koji mold) Predicted protein.
Carboxypeptidase_S10 : aspor-CPIAspergillus oryzae carboxypeptidase s1 precursor (EC 3.4.16.6), aspor-q2twj3Aspergillus oryzae Aspergillus flavus serine carboxypeptidases, aspor-q2tya1Aspergillus oryzae serine carboxypeptidase, aspor-q2tyq4Aspergillus oryzae Aspergillus flavus carboxypeptidase c, aspor-q2u4g6Aspergillus oryzae Aspergillus flavus serine carboxypeptidase, aspor-q2u6h7Aspergillus oryzae, Aspergillus flavus, serine carboxypeptidases, aspor-q2u908Aspergillus oryzae carboxypeptidase c, aspor-q2uc77Aspergillus oryzae carboxypeptidase c, aspor-q2uec1Aspergillus oryzae serine carboxypeptidase, aspor-q2ugg7Aspergillus oryzae (Yellow koji mold) serine carboxypeptidase, aspor-q2uhn1Aspergillus oryzae carboxypeptidase c, aspor-q2upi1Aspergillus oryzae (Yellow koji mold) KEX1 serine carboxypeptidase.
CFTR-inhibitory-factor_Cif : aspor-q2ugd6Aspergillus oryzae predicted hydrolases or acyltransferases.
CGI-58_ABHD5_ABHD4 : aspor-q2uk42Aspergillus oryzae and Aspergillus flavus (strain ATCC200026/FGSCA1120/NRRL3357/JC12722/SRRC167) predicted hydrolase/acyltransferase.
Cocaine_esterase : aspor-q2u4f6Aspergillus oryzae predicted acyl esterases, aspor-q2u5f5Aspergillus oryzae Aspergillus flavus predicted acyl esterases, aspor-q2u854Aspergillus oryzae predicted acyl esterases, aspor-q2uc98Aspergillus oryzae predicted acyl esterases, aspor-q2ufd8Aspergillus oryzae predicted acyl esterases, aspor-q2uhq0Aspergillus oryzae predicted acyl esterases.
Cutinase : aspor-cutas

Aspergillus oryzae (Yellow koji mold), Aspergillus flavus, CutL1 gene for cutinase cutinase 1 precursor (EC 3.1.1.74) (cutin hydrolase 1) (l1), aspor-cuti2Aspergillus oryzae, Aspergillus flavus (strain ATCC200026/FGSC A1120/NRRL 3357/JC12722/SRRC 167)probable cutinase 2 precursor (EC 3.1.1.74) (cutin hydrolase 2), aspor-q2u199Aspergillus oryzae; Aspergillus flavus (strain ATCC 200026/FGSC A1120/NRRL 3357/JC12722/SRRC 167) CutC CUTI3 predicted protein, aspor-q2uih1Aspergillus oryzae (Yellow koji mold) predicted protein, aspor-TGLAAspergillus oryzae, Aspergillus flavus triacylglycerol lipase.
Dienelactone_hydrolase : aspor-q2uiu1Aspergillus oryzae predicted hydrolase related to dienelactone hydrolase, aspor-q2uli9Aspergillus oryzae predicted hydrolase related to dienelactone hydrolase, aspor-q2uru5Aspergillus oryzae predicted hydrolase related to dienelactone hydrolase, aspor-q2usp7Aspergillus oryzae predicted hydrolase related to dienelactone hydrolase.
DPP4N_Peptidase_S9 : aspor-DPPIVAspergillus oryzae Aspergillus flavus (strain ATCC 200026/FGSC A1120/NRRL 3357/JC12722/SRRC 167) dipeptidyl aminopeptidase IV, aspor-q2upw4Aspergillus oryzae, Aspergillus flavus, dipeptidyl aminopeptidase.
Duf_676 : aspor-q2u728Aspergillus oryzae predicted alpha/beta hydrolase, aspor-q2urq0Aspergillus oryzae predicted alpha/beta hydrolase.
Duf_726 : aspor-q2uf48Aspergillus oryzae Uncharacterized conserved protein, aspor-q2uk31Aspergillus oryzae, Aspergillus flavus, DUF726 domain protein.
Duf_829 : aspor-q2u3k5Aspergillus oryzae Predicted protein, aspor-q2urf3Aspergillus oryzae Predicted protein.
Duf_1100-S : aspor-q2uab6Aspergillus oryzae; Aspergillus flavus predicted hydrolases or acyltransferases, aspor-q2usq8Aspergillus oryzae predicted protein.
Epoxide_hydrolase : aspor-q2u3a6Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2u4a0Aspergillus oryzae, Aspergillus flavus, (na+-independent cl/hco3 exchanger ae1 and related transporters i c-term not related.), aspor-q2u489Aspergillus oryzae, Aspergillus flavus Epoxide hydrolase, putative, aspor-q2ub32Aspergillus oryzae, Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) soluble epoxide hydrolase, aspor-q2ucy7Aspergillus oryzae, Aspergillus flavus, soluble epoxide hydrolase, aspor-q2ugi2Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2uja2Aspergillus oryzae predicted hydrolases or acyltransferases, aspor-q2ulv7Aspergillus oryzae soluble epoxide hydrolase, aspor-q2uq56Aspergillus oryzae predicted hydrolases or acyltransferases.
Esterase_phb : aspor-q2ur69Aspergillus oryzae (Yellow koji mold) Feruloyl esterase, aspor-axe1Aspergillus oryzae; Aspergillus flavus Acetylxylan esterase A.
FaeC : aspor-q2u7d3Aspergillus oryzae (Yellow koji mold); Aspergillus parasiticus; Aspergillus arachidicola; Aspergillus flavus; Aspergillus bombycis Uncharacterized protein, aspor-faecAspergillus oryzae; Aspergillus flavus Ferulic acid esterase C.
FSH1 : aspor-q2twv2Aspergillus oryzae; Aspergillus flavus; Aspergillus parasiticus; Aspergillus arachidicola, predicted protein, aspor-q2u4h9Aspergillus oryzae; Aspergillus flavus; Aspergillus parasiticus; Aspergillus bombycis phospholipase/carboxyhydrolase, aspor-q2u6m9Aspergillus oryzae; Aspergillus flavus; Aspergillus parasiticus; Aspergillus arachidicola Aspergillus nomius; Aspergillus bombycis predicted protein, aspor-q2u7i2Aspergillus oryzae; Aspergillus flavus; Aspergillus parasiticus. Aspergillus arachidicola predicted protein, aspor-q2u8j8Aspergillus oryzae; Aspergillus flavus; Aspergillus parasiticus; Aspergillus arachidicola predicted protein.
Fungal-Bact_LIP : aspor-q2twc4Aspergillus oryzae , Aspergillus flavus, Lipase 8, putative, aspor-q2tyn9Aspergillus oryzae, Aspergillus flavus Lipase 2, putative, aspor-q2u1m8Aspergillus oryzae Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC12722 / SRRC 167) predicted protein, aspor-q2u798Aspergillus oryzae, Aspergillus flavus, Lipase 1, putative, aspor-q2ud23Aspergillus oryzae, Aspergillus flavus, Lipase, putative, aspor-q2udn5Aspergillus oryzae, Aspergillus flavus, Lipase 2, putative, aspor-q2uix9Aspergillus oryzae, Aspergillus flavus Secretory lipase AflaL0.
Fungal_carboxylesterase_lipase : aspor-q2tw11Aspergillus oryzae, Aspergillus flavus, Extracellular lipase, putative lipO745, aspor-q2tz03Aspergillus oryzae carboxylesterase and related proteins, aspor-q2tzh3Aspergillus oryzae (Yellow koji mold), Aspergillus flavus carboxylesterase, aspor-q2tzr5Aspergillus oryzae, Aspergillus flavus, predicted protein, aspor-q2u0k7Aspergillus oryzae carboxylesterase (Yellow koji mold), Aspergillus flavus, carboxylesterase, aspor-q2u1a6Aspergillus oryzae, Aspergillus flavus, predicted protein carboxylesterase and related proteins, aspor-q2u2a4Aspergillus oryzae, Aspergillus flavus, carboxylesterase type b, aspor-q2u3a3Aspergillus oryzae (Yellow koji mold), Aspergillus flavus, carboxylesterase type b, aspor-q2u5n3Aspergillus oryzae carboxylesterase type b (3.042; 100-8) (Yellow koji mold) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC12722 / SRRC 167), aspor-q2u8r4Aspergillus oryzae, Aspergillus flavus, Aspergillus parasiticus carboxylesterase type b, aspor-q2u8t5Aspergillus oryzae (Yellow koji mold), Aspergillus flavus, carboxylesterase type b, aspor-q2u875Aspergillus oryzae, Aspergillus flavus, carboxylesterase type b, aspor-q2uc28Aspergillus oryzae, Aspergillus flavus, carboxylesterase type b, aspor-q2udr0Aspergillus oryzae (Yellow koji mold) carboxylesterase type b, aspor-q2ug78Aspergillus oryzae carboxylesterase type b Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC12722 / SRRC 167), aspor-q2ugl2Aspergillus oryzae, Aspergillus flavus, carboxylesterase and related proteins, aspor-q2uh73Aspergillus oryzae Aspergillus flavus; Aspergillus nomius, carboxylesterase type b, aspor-q2ui56Aspergillus oryzae carboxylesterase type b (3.042; 100-8) (Yellow koji mold) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / J12722 / SRRC 167), aspor-q2uie9Aspergillus oryzae, Aspergillus flavus, carboxylesterase type b, aspor-q2uik9Aspergillus oryzae carboxylesterase type b, aspor-q2uiq0Aspergillus oryzae, Aspergillus flavus (Yellow koji mold)) carboxylesterase type b, aspor-q2uv29Aspergillus oryzae, Aspergillus flavus, putative carboxylesterase and related proteins.
Fusarinine_C_esterase_sidJ : aspor-q2typ0Aspergillus oryzae. predicted hydrolases or acyltransferases, aspor-q2u9a1Aspergillus oryzae (Yellow koji mold), Aspergillus flavus, predicted hydrolases or acyltransferases.
Haloperoxidase : aspor-q2ud06Aspergillus oryzae Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) predicted hydrolases or acyltransferases.
Homoserine_transacetylase : aspor-q2u6j5Aspergillus oryzae homoserine acetyltransferase, aspor-q2u8z3Aspergillus oryzae homoserine acetyltransferase, aspor-q2uqm7Aspergillus oryzae homoserine acetyltransferase.
Hormone-sensitive_lipase_like : aspor-Q2U722Aspergillus oryzae (Yellow koji mold) cytoplasmic alpha/beta-hydrolase autA AO090120000003, aspor-q2tw16Aspergillus oryzae arylacetamide deacetylase, aspor-q2tw28Aspergillus oryzae predicted protein, aspor-q2u0r6Aspergillus oryzae predicted protein, aspor-q2u212Aspergillus oryzae predicted protein, aspor-q2ua10Aspergillus oryzae arylacetamide deacetylase, aspor-q2uck0Aspergillus oryzae predicted protein, aspor-q2uf10Aspergillus oryzae predicted protein, aspor-q2ufe5Aspergillus oryzae predicted protein, aspor-q2ufz8Aspergillus oryzae Aspergillus flavus esta esterase/lipase, aspor-q2ugy9Aspergillus oryzae, Aspergillus flavus, predicted protein, aspor-q2uhe4Aspergillus oryzae predicted protein, aspor-q2uju3Aspergillus oryzae esterase/lipase, aspor-q2ukq7Aspergillus oryzae predicted protein, aspor-q2umv2Aspergillus oryzae arylacetamide deacetylase, aspor-q2uqb4Aspergillus oryzae arylacetamide deacetylase, aspor-q2ur83Aspergillus oryzae esterase/lipase, aspor-q2urg5Aspergillus oryzae predicted protein, asppa-q6ueg5Aspergillus parasiticus Versiconal hemiacetal acetate esterase aflJ (estA).
LIDHydrolase : aspor-q2u7v0Aspergillus oryzae Predicted protein.
Lipase_3 : aspor-MDLB

Aspergillus oryzae, Aspergillus flavus, Aspergillus tamarii, Aspergillus parasiticus diacylglycerol lipase, aspor-q2u4w9Aspergillus oryzae predicted protein, aspor-q2u6n6Aspergillus oryzae predicted protein, aspor-q2u331Aspergillus oryzae predicted protein, aspor-q2ufm4Aspergillus oryzae predicted protein, aspor-q2uib2Aspergillus oryzae predicted protein, aspor-q2uj89Aspergillus oryzae, Aspergillus flavus, Extracellular lipase, putative, aspor-q2umf3Aspergillus oryzae; Aspergillus flavus Extracellular triacylglycerol lipase, aspor-q2unw5Aspergillus oryzae Aspergillus flavus (strain ATCC 200026/FGSC A1120/NRRL 3357/JC12722/SRRC 167) Ferulic acid esterase A AoFae1, aspor-q2up23Aspergillus oryzae, Aspergillus flavus, predicted protein.
LYsophospholipase_carboxylesterase : aspor-q2u6m8Aspergillus oryzae lysophospholipase, aspor-q2u400Aspergillus oryzae predicted protein.
Monoglyceridelipase_lysophospholip : aspor-q2u4y8Aspergillus oryzae, Aspergillus flavus, lysophospholipase.
MpaH : aspor-q2u822Aspergillus oryzae predicted protein, aspoz-a0a1s9d9g3Aspergillus oryzae (Yellow koji mold); Aspergillus parasiticus; Aspergillus arachidicola; Aspergillus novoparasiticus; Aspergillus flavus. AB hydrolase-1 domain-containing protein.
PAF-Acetylhydrolase : aspor-q2ud03Aspergillus oryzae predicted dienelactone hydrolase.
Palmitoyl-protein_thioesterase : aspor-q2uc65Aspergillus oryzae palmitoyl protein thioesterase.
PC-sterol_acyltransferase : aspor-q2ul81Aspergillus oryzae, Aspergillus flavus, lecithin:cholesterol acyltransferase.
PGAP1 : aspor-q2usi0Aspergillus oryzae negative regulator of copii vesicle formation.
PMH_Peptidase_S9 : aspor-q2u3l6Aspergillus oryzae, Aspergillus flavus dipeptidyl aminopeptidases/acylaminoacyl- peptidases.
PPase_methylesterase_euk : aspor-ppme1Aspergillus oryzae Protein phosphatase methylesterase 1.
Proline_iminopeptidase : aspor-q2ulr2Aspergillus oryzae (Yellow koji mold), Aspergillus flavus predicted hydrolases or acyltransferases, aspor-q2ur64Aspergillus oryzae Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) predicted protein.
Prolylcarboxypeptidase : aspor-q2u0q2Aspergillus oryzae, Aspergillus flavus, Serine peptidase, family S28, putative, aspor-q2ub76Aspergillus oryzae, Aspergillus flavus, hydrolytic enzymes of the alpha/beta hydrolase fold, aspor-q2ukb6Aspergillus oryzae Aspergillus flavus, predicted protein.
Prolyl_oligopeptidase_S9 : aspor-q2urt4Aspergillus oryzae dipeptidyl aminopeptidase.
Tannase : aspor-q2twg0Aspergillus oryzae predicted protein, aspor-q2tx21Aspergillus oryzae predicted protein, aspor-q2tyh6Aspergillus oryzae predicted protein, aspor-q2u9n5Aspergillus oryzae, Aspergillus flavus, predicted protein, aspor-q2ubd6Aspergillus oryzae, Aspergillus flavus (strain ATCC 200026/FGSC A1120/NRRL 3357/JC12722/SRRC 167) SF3 Ferulic acid esterase B-2, aspor-q2uf27Aspergillus oryzae Tannase lipAO, aspor-q2uh24Aspergillus oryzae Carboxylic ester hydrolase AoTan2, aspor-q2uii1Aspergillus oryzae AotanB predicted protein, aspor-q2umx6

Aspergillus oryzae; Aspergillus flavus, Ferulic acid esterase B-2 faeB-2 feruloyl esterase AoFaeC AoTan1, aspor-q2up89

Aspergillus oryzae feruloyl esterase B-1 AoFaeB feruloyl esterase faeB-1 AoTan3, aspor-tanAspergillus oryzae (Yellow koji mold), Aspergillus flavus, AotanA tannase 30 kda subunit P78581.
Thioesterase : aspor-PKSL1

Aspergillus oryzae and Aspergillus sp. L Aspergillus flavus Aspergillus parasiticus aflatoxin biosynthesis pksa polyketide synthase, aspor-q2txq8Aspergillus oryzae polyketide synthase modules and related proteins, aspor-q2u2a1Aspergillus oryzae non-ribosomal peptide synthetase modules and related proteins, aspor-q2u4e0Aspergillus oryzae non-ribosomal peptide synthetase modules and related proteins, aspor-q2ua48Aspergillus oryzae polyketide synthase modules and related proteins, aspor-q2uge1Aspergillus oryzae polyketide synthase modules and related proteins, aspor-q2upe6Aspergillus oryzae Acyl-CoA synthetases, aspor-q2ur58Aspergillus oryzae; Aspergillus flavus polyketide synthase modules and related proteins. Thioesterase domain, aspor-q2ur80Aspergillus oryzae predicted protein, aspor-q2uux8Aspergillus oryzae polyketide synthase modules and related proteins.
Xaa-Pro-like_dom : aspor-q2ud08Aspergillus oryzae; Aspergillus parasiticus; Aspergillus flavus, hydrolases of the alpha/beta superfamily, aspo3-i7zz83Aspergillus oryzae (strain 3.042) (Yellow koji mold). Hydrolase of the alpha/beta superfamily

Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		2 Genbank : AF125190, EQ963476 2 UniProt : Q9Y8E3, B8NBM3 2 UniProt : Q9Y8E3, B8NBM3 2 Interpro : Q9Y8E3, B8NBM3 2 Pfam : Q9Y8E3, B8NBM3 2 PIRSF : Q9Y8E3, B8NBM3 2 SUPERFAM : Q9Y8E3, B8NBM3

Sequence

Peptide

Graphical view for this peptide sequence: aspor-Q9Y8E3
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
MGALRWLSIAATASTALALNPEGLISAPRRSEAIPNPSGDVAVFSQSQYS FKTHKTTSQWNVLDLKSGDIKLLTNDSDVSEIVWLGSDDSTVLYVNGTNA DIPGGVELWVSDISDFANGYKAASLPASFSGFKVVTTDSGDVRYVAYAES WANGTAYNEELVAKPLSSARIYDSIYVRHWDYYLTTRFNAVFSGTLKKSE GKGKATYKADGDLKNLVSPVKNAESPYPPFGGASDYDLSPDGKWVAFKSK AHDIPRANYTTAYIFLVPHDGSKTAVPINGPDSPGTPEGVKGDAGSPVFS PDSKKIAYWQMADESYEADHRTLYVYTVGSEETIPSLAADWDRSLDSVKW ADDDNLIIGVEDAGRSRLFSIPADAGDDYKPKNFTDGGVVSAYYQLPDST YLVTSTAIWTSWNVYIASPEKGVIKTLATANKIDPELKGLGPEIVDEFYY EGNWTKIQAFVIYPENFDKSKSYPLLYYIHGGPQSSWLDSWSTRWNPKVF ADQGYVVVAPNPTGSSGFGDALQDAIQNQWGGYPYEDLVKGWEYVNENFD FIDTDNGVAAGASYGGFMINWIQGSDLGRKFKALVSHDGTFVADAKVSTE ELWFMQHEFNGTFWDNRENYRRWDPSAPERILKFSTPMLIIHSDLDYRLP VSEGLSLFNILQERGVPSRFLNFPDENHWVQNKENSLVWHQQVLGWLNKY SGVEESNEDAVSLDDTVIPVVDYNP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MGALRWLSIAATASTALALNPEGLISAPRRSEAIPNPSGDVAVFSQSQYS
FKTHKTTSQWNVLDLKSGDIKLLTNDSDVSEIVWLGSDDSTVLYVNGTNA
DIPGGVELWVSDISDFANGYKAASLPASFSGFKVVTTDSGDVRYVAYAES
WANGTAYNEELVAKPLSSARIYDSIYVRHWDYYLTTRFNAVFSGTLKKSE
GKGKATYKADGDLKNLVSPVKNAESPYPPFGGASDYDLSPDGKWVAFKSK
AHDIPRANYTTAYIFLVPHDGSKTAVPINGPDSPGTPEGVKGDAGSPVFS
PDSKKIAYWQMADESYEADHRTLYVYTVGSEETIPSLAADWDRSLDSVKW
ADDDNLIIGVEDAGRSRLFSIPADAGDDYKPKNFTDGGVVSAYYQLPDST
YLVTSTAIWTSWNVYIASPEKGVIKTLATANKIDPELKGLGPEIVDEFYY
EGNWTKIQAFVIYPENFDKSKSYPLLYYIHGGPQSSWLDSWSTRWNPKVF
ADQGYVVVAPNPTGSSGFGDALQDAIQNQWGGYPYEDLVKGWEYVNENFD
FIDTDNGVAAGASYGGFMINWIQGSDLGRKFKALVSHDGTFVADAKVSTE
ELWFMQHEFNGTFWDNRENYRRWDPSAPERILKFSTPMLIIHSDLDYRLP
VSEGLSLFNILQERGVPSRFLNFPDENHWVQNKENSLVWHQQVLGWLNKY
SGVEESNEDAVSLDDTVIPVVDYNP

No Reference

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer