Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspor-q2u9a1

Aspergillus oryzae (Yellow koji mold), Aspergillus flavus, predicted hydrolases or acyltransferases

Comment
Other strains: Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167)


Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Aspergillus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP007164, EQ963477
2 UniProt : Q2U9A1, B8NDS7
2 UniProt : Q2U9A1, B8NDS7
2 Interpro : Q2U9A1, B8NDS7
2 Pfam : Q2U9A1, B8NDS7
2 PIRSF : Q2U9A1, B8NDS7
2 SUPERFAM : Q2U9A1, B8NDS7
Sequence
Graphical view for this peptide sequence: aspor-q2u9a1
Colored MSA for Duf_1749 (raw)
MQLKLPNALAKGQPGILHQYAERLVAFEFTRGNQRKPHSLIFIGGLSDGL
WTVDYMTDLVAALQHSEWSVFSLVLSSSYNGWGVGRLGKDIDEIAQCVQY
VRDYKKQLFGAGKVVIMGHSTGSQDVMHYLSCPNPRPRHPVLDREIDPLT
RTPVDGAIMQAPVSDRESILSVLNDGTERDSPEVMQELYRKAVAHAKENT
YEDDDTVETVVPLSVTARIGYPSSTAVSSRRFLSLASPDSPRKPDEDDLF
SSDLSDEQLQQTFGVVGSRGLLKSKFMVLYSGRDQSVPPWVNKETLLKRW
STAAGPSWHPKSMIIPNASHALSDPDQAEPRRILAERVIAYLDEVAQEV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLKLPNALAKGQPGILHQYAERLVAFEFTRGNQRKPHSLIFIGGLSDGL
WTVDYMTDLVAALQHSEWSVFSLVLSSSYNGWGVGRLGKDIDEIAQCVQY
VRDYKKQLFGAGKVVIMGHSTGSQDVMHYLSCPNPRPRHPVLDREIDPLT
RTPVDGAIMQAPVSDRESILSVLNDGTERDSPEVMQELYRKAVAHAKENT
YEDDDTVETVVPLSVTARIGYPSSTAVSSRRFLSLASPDSPRKPDEDDLF
SSDLSDEQLQQTFGVVGSRGLLKSKFMVLYSGRDQSVPPWVNKETLLKRW
STAAGPSWHPKSMIIPNASHALSDPDQAEPRRILAERVIAYLDEVAQEV


Reference
    Title: Genome sequencing and analysis of Aspergillus oryzae
    Machida M, Asai K, Sano M, Tanaka T, Kumagai T, Terai G, Kusumoto K, Arima T, Akita O and Kikuchi H <54 more author(s)>
    Ref: Nature, 438:1157, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer