Gene_locus Report for: asptn-dpp5

Aspergillus terreus (strain NIH 2624 / FGSC A1156) Dipeptidyl-peptidase V

Relationship

Family	\|	Prolyl_oligopeptidase_S9
Block	\|	X
Position in NCBI Life Tree	\|	Aspergillus terreus

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus terreus: N E

There are 112 a/b hydrolases in Aspergillus terreus view in a: Table

6_AlphaBeta_hydrolase : asptn-q0c7g6Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0c9n3Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0c860Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cat4Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0cgt3Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0ci39Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0cis0Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0cj96Aspergillus terreus (strain NIH 2624) predicted protein, asptn-q0cms8Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0cq04Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0crf6Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0ct87Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0ctb4Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cz24Aspergillus terreus (strain NIH 2624) predicted protein.
A85-EsteraseD-FGH : asptn-q0cip6Aspergillus terreus (strain NIH 2624 / FGSC A1156) Esterase D.
A85-IroE-IroD-Fes-Yiel : asptn-q0cqg2Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
ABHD13-BEM46 : asptn-q0cpn0Aspergillus terreus (strain NIH 2624 / FGSC A1156). Hydrolase_4 domain-containing protein.
abh_upf0017 : asptn-q0ch57Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Acetylxylan_esterase : asptn-q0cqh8Aspergillus terreus (strain NIH 2624 / FGSC A1156) Acetylxylan esterase, asptn-q0cnm5Aspergillus terreus (strain NIH 2624 / FGSC A1156) Acetylxylan esterase.
Acidic_Lipase : asptn-q0cet1Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cib3Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Bacterial_esterase : asptn-q0cy59Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0czw6Aspergillus terreus (strain NIH 2624) putative uncharacterized protein.
BD-FAE : asptn-q0cvd2Aspergillus terreus (strain NIH 2624) predicted protein, asptn-trt4Aspergillus terreus (strain NIH 2624 / FGSC A1156). Terretonin synthesis protein 4, asptn-5moasAspergillus terreus (strain NIH 2624 / FGSC A1156). Non-reducing polyketide synthase ATEG_03629. Thioesterase last domain.
Canar_LipB : asptn-q0cjs0Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cpv1Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein.
Carboxypeptidase_S10 : asptn-q0cg19Aspergillus terreus (strain NIH 2624 / FGSC A1156) Carboxypeptidase S1, asptn-kex1Aspergillus terreus (strain NIH 2624 / FGSC A1156). Carboxypeptidase D, asptn-cbpyaAspergillus terreus (strain NIH 2624 / FGSC A1156). Carboxypeptidase Y homolog A.
CFTR-inhibitory-factor_Cif : asptn-q0ckr1Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0cp98Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein.
CGI-58_ABHD5_ABHD4 : asptn-q0cr64Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Cutinase : asptn-cuti1Aspergillus terreus (strain NIH 2624 / FGSC A1156) Cutin hydrolase 1, asptn-cuti2Aspergillus terreus (strain NIH 2624 / FGSC A1156) Cutin hydrolase 2, asptn-cuti3Aspergillus terreus (strain NIH 2624 / FGSC A1156) Cutin hydrolase 3, asptn-cuti4Aspergillus terreus (strain NIH 2624 / FGSC A1156) Cutin hydrolase 4, asptn-cuti5Aspergillus terreus (strain NIH 2624 / FGSC A1156) Cutin hydrolase 5, asptn-q0cz47Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein.
DPP4N_Peptidase_S9 : asptn-dapbAspergillus terreus (strain NIH 2624 / FGSC A1156) Probable dipeptidyl-aminopeptidase B, asptn-q0cm15Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Duf_726 : asptn-q0cr50Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cyj0Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Duf_829 : asptn-q0cn88Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0d199Aspergillus terreus (strain NIH 2624) Predicted protein.
Epoxide_hydrolase : asptn-q0cb76Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0ccj0Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0ci99Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Esterase_phb : asptn-axe1Aspergillus terreus (strain NIH 2624 / FGSC A1156) Probable acetylxylan esterase A.
FaeC : asptn-faecAspergillus terreus (strain NIH 2624 / FGSC A1156) Ferulic acid esterase C, asptn-q0ci40Aspergillus terreus (strain NIH 2624 / FGSC A1156). ATEG_06644 AtFaeD, asptn-q0cwm0Aspergillus terreus (strain NIH 2624 / FGSC A1156). CBM1 domain-containing protein.
FSH1 : asptn-LOVGAspergillus terreus (strain NIH 2624 / FGSC A1156) Esterase LovG, aspte-Q9Y7C9Aspergillus terreus hypothetical protein, asptn-azpb5Aspergillus terreus (strain NIH 2624 / FGSC A1156). Azasperpyranone A biosynthesis cluster B protein ATEG_07663.
Fungal-Bact_LIP : asptn-q0cj90Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cmu9Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0cry4Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein, asptn-q0cz14Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0czh3Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein.
Fungal_carboxylesterase_lipase : asptn-q0c7i9Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0c7j4Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0c8p0Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0c9e7Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0ccb4Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0cce4Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0cjm6Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0ckc5Aspergillus terreus (strain NIH 2624) predicted protein, asptn-q0cmr8Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0cqj2Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0csf6Aspergillus terreus (strain NIH 2624) predicted protein, asptn-q0cug8Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0cum8Aspergillus terreus (strain NIH 2624) predicted protein, asptn-q0cv09Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0cwz7Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0cxl7Aspergillus terreus (strain NIH 2624) Putative uncharacterized protein, asptn-q0cya0Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0czb3Aspergillus terreus (strain NIH 2624) putative uncharacterized protein, asptn-q0d143Aspergillus terreus (strain NIH 2624) putative uncharacterized protein.
Fusarinine_C_esterase_sidJ : asptn-q0cp11Aspergillus terreus (strain NIH 2624 / FGSC A1156) Dolichol-phosphate mannosyltransferase, asptn-q0cuc2Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Glucuronoyl_esterase : asptn-q0czd9Aspergillus terreus (strain NIH 2624 / FGSC A1156) Uncharacterized protein.
GTSAGmotif : asptn-q0cg08Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein.
Haloperoxidase : asptn-q0d142Aspergillus terreus (strain NIH 2624) non-heme chloroperoxidase.
Hormone-sensitive_lipase_like : asptn-q0cgs6Aspergillus terreus (strain NIH 2624) predicted protein, asptn-pytbAspergillus terreus (strain NIH 2624 / FGSC A1156). Pyranterreones biosynthesis cluster protein B;.
Kynurenine-formamidase : asptn-q0d1j3Aspergillus terreus (strain NIH 2624 / FGSC A1156). N-formylkynurenine formamidase.
LIDHydrolase : asptn-q0cd92Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein.
Lipase_3 : asptn-atg15Aspergillus terreus (strain NIH 2624 / FGSC A1156) Autophagy-related protein 15, asptn-faeaAspergillus terreus (strain NIH 2624/FGSC A1156) Ferulic acid esterase A.
MpaH : asptn-q0ct68Aspergillus terreus (strain NIH 2624 / FGSC A1156). AB hydrolase-1 domain-containing protein.
PGAP1 : asptn-bst1Aspergillus terreus (strain NIH 2624 / FGSC A1156) GPI inositol-deacylase.
PPase_methylesterase_euk : asptn-q0cwi5Aspergillus terreus (strain NIH 2624 / FGSC A1156) Protein phosphatase methylesterase 1.
Prolylcarboxypeptidase : asptn-q0c8h2Aspergillus terreus (strain NIH 2624 / FGSC A1156) Putative uncharacterized protein, asptn-q0cvt7Aspergillus terreus (strain NIH 2624 / FGSC A1156) Predicted protein.
Tannase : asptn-faeb1Aspergillus terreus (strain NIH 2624 / FGSC A1156) Ferulic acid esterase B-1, asptn-faeb2Aspergillus terreus (strain NIH 2624 / FGSC A1156) Ferulic acid esterase B-2.
Thioesterase : aspte-AT1Aspergillus terreus polyketide synthase. Terrein biosynthesis cluster protein terA, from aa 1680 thioesterase module, aspte-AT4Aspergillus terreus polyketide synthase (fragment thioesterase module), asptn-apvaAspergillus terreus (strain NIH 2624 / FGSC A1156). Aspulvinone E synthase Thioesterase domain, asptn-atqaAspergillus terreus (strain NIH 2624 / FGSC A1156). Didemethylasterriquinone synthetase Thioesterase domain, asptn-btyaAspergillus terreus (strain NIH 2624 / FGSC A1156). Butyrolactone IIa synthetase Thioesterase domain, aspte-curs2Aspergillus terreus. Dehydrocurvularin biosynthesis protein 2. Thioesterase domain, asptn-atraAspergillus terreus (strain NIH 2624 / FGSC A1156). Atromentin synthetase. Thioesterase domain, aspte-melaAspergillus terreus. Nonribosomal peptide synthetase melA. Thioesterase domain, asptn-melaAspergillus terreus (strain NIH 2624 / FGSC A1156). Nonribosomal peptide synthase melA. Thioesterase domain, asptn-pngaAspergillus terreus (strain NIH 2624 / FGSC A1156). Phenguignardic acid synthase. Thioesterase domain, aspte-pytiAspergillus terreus. Pyranterreones biosynthesis cluster protein I.
Thiohydrolase : asptn-q0cnl5Aspergillus terreus (strain NIH 2624 / FGSC A1156). Hydrolase_4 domain-containing protein

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		1 Genbank : CH476608 1 UniProt : Q0C8V9 1 UniProt : Q0C8V9 1 Interpro : Q0C8V9 1 Pfam : Q0C8V9 1 PIRSF : Q0C8V9 1 SUPERFAM : Q0C8V9

Sequence

Peptide

Graphical view for this peptide sequence: asptn-dpp5
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
MAALRWLSAVVAVSTTVLAITPEQMLSAPRRGEAIPNPSGNVALFSASQY SFDTKEKSSSWNLLNLKTGDITLLTDDANVSEIVWLGGDDTSLLYINGTN AEIPGGVELWVSSVKDFSKGYKAASLGASFSGLKAVRTRSGDIKFAVNAQ SYANGTAYNEELATKYASTARIYDSIYVRHWDTYLTTTFNAVFAGTLKKG KHQYASAGPLKNLVAPVKNAESPYPPFGDSTDYDVSPDGKWVAFKSKAPD VPRANYTTAYIYLAPHDGSSTATPINGPDSPGTPEGVQGDANYPVFSPDS RHLAYFQMAHKSYESDRRVLYVYTLGSKTTTPAVAGDWNRSPDSAKWLDN KHLILGSEDHARVRLFGPVPIDADDDFKPQNFTDGGAVSSYHVLPDKTVL VTGTAIWTSWNVYTASPKKGVIKTIASANKIDPGLAGLGPEDISEFYYDG NWTKIQSWIIYPENFDSSKKYPLFFYIHGGPQSATPDSWSTRWNAKVFAD QGYVVVAPNPTGSTGFGQELTDAIANNWGGAPYEDLVKAWEYVDKNLPYV DTENGVAAGASYGGFMINWIQGSDLGRKFKALVCHDGTFVADAKISTEEL WFIEHDFNGTFWGARDNYRRWDPSAPERILQFSTPQLVIHSDQDYRLPVA EGLAMFNVLQERGVPSRFLNFPDENHWVLKQENSLVWHQQMLGWLNRYSG IEEANPDAVSLDDTIIPVVNYNP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MAALRWLSAVVAVSTTVLAITPEQMLSAPRRGEAIPNPSGNVALFSASQY
SFDTKEKSSSWNLLNLKTGDITLLTDDANVSEIVWLGGDDTSLLYINGTN
AEIPGGVELWVSSVKDFSKGYKAASLGASFSGLKAVRTRSGDIKFAVNAQ
SYANGTAYNEELATKYASTARIYDSIYVRHWDTYLTTTFNAVFAGTLKKG
KHQYASAGPLKNLVAPVKNAESPYPPFGDSTDYDVSPDGKWVAFKSKAPD
VPRANYTTAYIYLAPHDGSSTATPINGPDSPGTPEGVQGDANYPVFSPDS
RHLAYFQMAHKSYESDRRVLYVYTLGSKTTTPAVAGDWNRSPDSAKWLDN
KHLILGSEDHARVRLFGPVPIDADDDFKPQNFTDGGAVSSYHVLPDKTVL
VTGTAIWTSWNVYTASPKKGVIKTIASANKIDPGLAGLGPEDISEFYYDG
NWTKIQSWIIYPENFDSSKKYPLFFYIHGGPQSATPDSWSTRWNAKVFAD
QGYVVVAPNPTGSTGFGQELTDAIANNWGGAPYEDLVKAWEYVDKNLPYV
DTENGVAAGASYGGFMINWIQGSDLGRKFKALVCHDGTFVADAKISTEEL
WFIEHDFNGTFWGARDNYRRWDPSAPERILQFSTPQLVIHSDQDYRLPVA
EGLAMFNVLQERGVPSRFLNFPDENHWVLKQENSLVWHQQMLGWLNRYSG
IEEANPDAVSLDDTIIPVVNYNP

No Reference

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer