Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: astec-e8rup5

Asticcacaulis excentricus (strain ATCC 15261 / DSM 4724 / VKM B-1370 / CB 48) Putative peptidase

Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Asticcacaulis excentricus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Caulobacterales: N E > Caulobacteraceae: N E > Asticcacaulis: N E > Asticcacaulis excentricus: N E


Molecular evidence
Database
No mutation
2 structures: 5TXC, 5TXE
No kinetic





1 substrate:
Astexin3-dC4
No inhibitor
1 UniProt : E8RUP5
2 Structure : 5TXE, 5TXC
1 UniProt : E8RUP5
1 Interpro : E8RUP5
1 Pfam : E8RUP5
1 PIRSF : E8RUP5
1 SUPERFAM : E8RUP5
Sequence
Graphical view for this peptide sequence: astec-e8rup5
Colored MSA for ACPH_Peptidase_S9 (raw)
GCERQAKRLICAQESALQPRRLVTLNLTSGQMSPLYDPNPDLSRYRLPKV
ERLTLRNRNGIEVFSDLVLPPDYQLGTRLPLVIVQYSSRGFLRGGTGDEN
PILPLATAGFAVLSFHSPRSEASYQRFTSPIAQSKAEYSNWRNRWNILHT
LEDLIDDLDRRGVIDPARVGLTGLSDGATTVHFGLINSHRFAAAVTSSCC
TDSFTASVMNGPRISGALKAYGIETDQADDGPFWAATSFVVNASRLDTPL
LIQSADEEYLGALPGFTALQQARKPVELIIYPNEHHVKWQPAHRLAVYNR
TIDWFRFWLMDQSDPAPDKAAQYDRWRALRALRQKSPSPTPAP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GCERQAKRLICAQESALQPRRLVTLNLTSGQMSPLYDPNPDLSRYRLPKV
ERLTLRNRNGIEVFSDLVLPPDYQLGTRLPLVIVQYSSRGFLRGGTGDEN
PILPLATAGFAVLSFHSPRSEASYQRFTSPIAQSKAEYSNWRNRWNILHT
LEDLIDDLDRRGVIDPARVGLTGLSDGATTVHFGLINSHRFAAAVTSSCC
TDSFTASVMNGPRISGALKAYGIETDQADDGPFWAATSFVVNASRLDTPL
LIQSADEEYLGALPGFTALQQARKPVELIIYPNEHHVKWQPAHRLAVYNR
TIDWFRFWLMDQSDPAPDKAAQYDRWRALRALRQKSPSPTPAP


Reference
    Title: Structure of the Lasso Peptide Isopeptidase Identifies a Topology for Processing Threaded Substrates
    Chekan JR, Koos JD, Zong C, Maksimov MO, Link AJ, Nair SK
    Ref: Journal of the American Chemical Society, 138:16452, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer