Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: azovd-c1dgm6

Azotobacter vinelandii (strain DJ / ATCC BAA-1303) Poly(3-hydroxybutyrate) depolymerase

Relationship
Family|Duf_3141
Block| X
Position in NCBI Life Tree|Azotobacter vinelandii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Azotobacter group: N E > Azotobacter: N E > Azotobacter vinelandii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001157
1 UniProt : C1DGM6
1 UniProt : C1DGM6
1 Interpro : C1DGM6
1 Pfam : C1DGM6
1 PIRSF : C1DGM6
1 SUPERFAM : C1DGM6
Sequence
Graphical view for this peptide sequence: azovd-c1dgm6
Colored MSA for Duf_3141 (raw)
MADASADPPAPWTLWNDWCRYGLDVAQRSILFWDTLRQRGDNYLEHVRQG
QPPLLHFEHETVLDGRTFARPVNYALLRILPPAGMEADPRQRPYLIIDPR
AGHGPGIGGFKDDSEVGVILRERHPVYFVAFFRLPEPGQSLLDVCAAEQV
FVRKVRELHPDSPKPALVGNCQGGWATMMLAATDPDSAGPVVINGAPMSY
WGGAWREGEGDNPMRYAGGLLGGTWLASLASDLGNGLFDGAHLVENFENL
NPANTYWDKYYHLFANIDGEPPRFLEFERWWGGYFLMNREEIEWITRNLF
VGNRLWSGETGAGRGKPVFDLRDIKSPIVLFASLGDNITPPQQAFNWVAD
IYASTEEIKARGQIIVGLLHQDIGHLGIFVSGRVARKEHAQIVSVLKSIE
MLPPGLYGMAIHERPGAGGKLEYEVEFHEHRLEDVSARLNRLQRVDEKPF
EAVAALSEFNQRGYELFLRPLVRLMASERSAELMRQLHPLRLQRWAFSAR
NPWLWWLAPAAAAVRKQRQAPVASRDDLPHHGERLASELISASLDHYRAL
RDAAGEALFFQTYGSLFSLILDESPPPAASAEAQELPFVQEALDAIGEGG
YDEAFARVAALLARKDELSLARLVTKQEIVRDYADLLPRLPPETWRRIRG
EQEIIVNYAREQALATLPALLAGPAERERLLTLLERLAADERVRRSEPSA
EQRAMLERIHDVLGRAPAVGQPTARSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADASADPPAPWTLWNDWCRYGLDVAQRSILFWDTLRQRGDNYLEHVRQG
QPPLLHFEHETVLDGRTFARPVNYALLRILPPAGMEADPRQRPYLIIDPR
AGHGPGIGGFKDDSEVGVILRERHPVYFVAFFRLPEPGQSLLDVCAAEQV
FVRKVRELHPDSPKPALVGNCQGGWATMMLAATDPDSAGPVVINGAPMSY
WGGAWREGEGDNPMRYAGGLLGGTWLASLASDLGNGLFDGAHLVENFENL
NPANTYWDKYYHLFANIDGEPPRFLEFERWWGGYFLMNREEIEWITRNLF
VGNRLWSGETGAGRGKPVFDLRDIKSPIVLFASLGDNITPPQQAFNWVAD
IYASTEEIKARGQIIVGLLHQDIGHLGIFVSGRVARKEHAQIVSVLKSIE
MLPPGLYGMAIHERPGAGGKLEYEVEFHEHRLEDVSARLNRLQRVDEKPF
EAVAALSEFNQRGYELFLRPLVRLMASERSAELMRQLHPLRLQRWAFSAR
NPWLWWLAPAAAAVRKQRQAPVASRDDLPHHGERLASELISASLDHYRAL
RDAAGEALFFQTYGSLFSLILDESPPPAASAEAQELPFVQEALDAIGEGG
YDEAFARVAALLARKDELSLARLVTKQEIVRDYADLLPRLPPETWRRIRG
EQEIIVNYAREQALATLPALLAGPAERERLLTLLERLAADERVRRSEPSA
EQRAMLERIHDVLGRAPAVGQPTARSA


Reference
    Title: Genome sequence of Azotobacter vinelandii, an obligate aerobe specialized to support diverse anaerobic metabolic processes
    Setubal JC, dos Santos P, Goldman BS, Ertesvag H, Espin G, Rubio LM, Valla S, Almeida NF, Balasubramanian D and Wood D <34 more author(s)>
    Ref: Journal of Bacteriology, 191:4534, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer