Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bac25-mglp

Bacillus sp.; Geobacillus kaustophilus; Geobacillus thermoleovorans; Anoxybacillus thermarum, monoacylglycerol lipase, CCR11 thermostable lipase

Comment
Other strains: Bacillus sp. (H-257; A8; WSUCF1; MAS1); Geobacillus kaustophilus (GBlys); Geobacillus thermoleovorans (Bacillus thermoleovorans) (CCB_US3_UF5; B23); Anoxybacillus thermarum strain AF/04; Geobacillus sp. 12AMOR1


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Bacillus sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
8 structures (e.g. : 3RLI, 3RM3, 4KE6... more)
No kinetic





1 substrate:
Monolaurin
4 inhibitors (e.g. : C12-myristoyl-MAG-like-phosphonate, C14-palmitoyl-MAG-like-phosphonate, C16-stearoyl-MAG-like-phosphonate... more)
Sequence
Graphical view for this peptide sequence: bac25-mglp
Colored MSA for CarbLipBact_2 (raw)
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTV
CLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGG
TLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLK
NPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVP
PGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTV
CLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGG
TLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLK
NPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVP
PGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHAG


References
12 more
    Title: Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase
    Rengachari S, Aschauer P, Schittmayer M, Mayer N, Gruber K, Breinbauer R, Birner-Gruenberger R, Dreveny I, Oberer M
    Ref: Journal of Biological Chemistry, 288:31093, 2013 : PubMed

            

    Title: The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes
    Rengachari S, Bezerra GA, Riegler-Berket L, Gruber CC, Sturm C, Taschler U, Boeszoermenyi A, Dreveny I, Zimmermann R and Oberer M <1 more author(s)>
    Ref: Biochimica & Biophysica Acta, 1821:1012, 2012 : PubMed

            

    Title: Monoacylglycerol lipase from moderately thermophilic Bacillus sp. strain H-257: molecular cloning, sequencing, and expression in Escherichia coli of the gene
    Kitaura S, Suzuki K, Imamura S
    Ref: J Biochem, 129:397, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer