Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: baca2-a7z1n9

Bacillus amyloliquefaciens (strain FZB42) Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus amyloliquefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus amyloliquefaciens group: N E > Bacillus amyloliquefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000560
1 UniProt : A7Z1N9
1 UniProt : A7Z1N9
1 Interpro : A7Z1N9
1 Prodom : A7Z1N9
1 Pfam : A7Z1N9
1 PIRSF : A7Z1N9
1 SUPERFAM : A7Z1N9
Sequence
Graphical view for this peptide sequence: baca2-a7z1n9
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSIYHKVIGEGYPIVMLHGWTLDHQVMLHAMEPLFEKRSGWKRIYIDLPG
MGHSKPQPSIQNSDDILEAILRLLDEIIPGQQFIVCGNSYGGYIARGIVR
SRQETVRGLLLMAPLTIPEFDERVVPQKTVLKRDSDLISQLSSEEADEFC
SMGIVQGKTEWERFRDEILLPSKQTNYEFINNIRQNGYGFTFDISSKLEY
PTLIITGRQDNVVGYHDAWRLLEDYPRATFAVLDMAGHNLQIEQTDVFNS
LVHNWLNRLESEIFRRYNFS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSIYHKVIGEGYPIVMLHGWTLDHQVMLHAMEPLFEKRSGWKRIYIDLPG
MGHSKPQPSIQNSDDILEAILRLLDEIIPGQQFIVCGNSYGGYIARGIVR
SRQETVRGLLLMAPLTIPEFDERVVPQKTVLKRDSDLISQLSSEEADEFC
SMGIVQGKTEWERFRDEILLPSKQTNYEFINNIRQNGYGFTFDISSKLEY
PTLIITGRQDNVVGYHDAWRLLEDYPRATFAVLDMAGHNLQIEQTDVFNS
LVHNWLNRLESEIFRRYNFS


Reference
    Title: Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42
    Chen XH, Koumoutsi A, Scholz R, Eisenreich A, Schneider K, Heinemeyer I, Morgenstern B, Voss B, Hess WR and Borriss R <9 more author(s)>
    Ref: Nat Biotechnol, 25:1007, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer