Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: baca2-a7z924

Bacillus amyloliquefaciens (Bacillus velezensis), Bacillus subtilis, Bacillus sp. PnbA CarCby

Comment
Other strains: Bacillus amyloliquefaciens (strains FZB42; IT-45; EBL11; subsp. plantarum CAU B946; YAU B9601-Y2; Y2; M27; AS43.3; IT-45; UCMB5036; UCMB5113; UCMB5033; EGD-AQ14; UASWS BA1; NAU-B3 CC178; TrigoCor1448; LFB112; SQR9); Bacillus sp. (5B6; 916), Bacillus subtilis; Bacillus velezensis; Bacillus vallismortis; Streptococcus pneumoniae; Mycobacterium abscessus subsp.


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Bacillus amyloliquefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus amyloliquefaciens group: N E > Bacillus amyloliquefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: baca2-a7z924
Colored MSA for Carb_B_Bacteria (raw)
MTKLTVQTRCGALKGTAGRGARTWKGIPYAKPPVGELRFKAPEPPAPWDG
VKHADSFGPVCPQPDDMLSISFSGDVPPQSEDCLYLNVFAPDSEGEKKPV
MVWIHGGAFYLGAGSEPLYDGSALAADGDVIVVTLNYRLGPFGFLHLSSI
HDTYSANIGLLDQIAALRWVKDNISEFGGDPDNVTIFGESAGGMSIAALM
AMPDAKGLFHKAILESGASHTIPADMAKDIAAAFIHEAGTDQLQELSVND
LLKTADKVRRSLDQNIFQLLFQPAIDPATLPAEPVKAIADGAAEGIPMII
GTNRDEAYLFFTPDTDIHSEKKQQDYLHYYLGENCTEQAADLYPHSLKGQ
IDMMTDLIFWRPAVAFAQGQSQHAPVWMYRFDWHGETPPFHKAVHALELP
FVFGNFDSLRKTLQEPLGDDAEQLSKQIQSAWLAFAKTGNPNTSHFNWPE
YDTDSRETLLFNTDTAVESDPDSAKRRILFQA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKLTVQTRCGALKGTAGRGARTWKGIPYAKPPVGELRFKAPEPPAPWDG
VKHADSFGPVCPQPDDMLSISFSGDVPPQSEDCLYLNVFAPDSEGEKKPV
MVWIHGGAFYLGAGSEPLYDGSALAADGDVIVVTLNYRLGPFGFLHLSSI
HDTYSANIGLLDQIAALRWVKDNISEFGGDPDNVTIFGESAGGMSIAALM
AMPDAKGLFHKAILESGASHTIPADMAKDIAAAFIHEAGTDQLQELSVND
LLKTADKVRRSLDQNIFQLLFQPAIDPATLPAEPVKAIADGAAEGIPMII
GTNRDEAYLFFTPDTDIHSEKKQQDYLHYYLGENCTEQAADLYPHSLKGQ
IDMMTDLIFWRPAVAFAQGQSQHAPVWMYRFDWHGETPPFHKAVHALELP
FVFGNFDSLRKTLQEPLGDDAEQLSKQIQSAWLAFAKTGNPNTSHFNWPE
YDTDSRETLLFNTDTAVESDPDSAKRRILFQA


References
5 more
    Title: Display of a novel carboxylesterase CarCby on Escherichia coli cell surface for carbaryl pesticide bioremediation
    Liu Y, Wang X, Nong S, Bai Z, Han N, Wu Q, Huang Z, Ding J
    Ref: Microb Cell Fact, 21:97, 2022 : PubMed

            

    Title: The complete genome of Bacillus amyloliquefaciens subsp. plantarum CAU B946 contains a gene cluster for nonribosomal synthesis of iturin A
    Blom J, Rueckert C, Niu B, Wang Q, Borriss R
    Ref: Journal of Bacteriology, 194:1845, 2012 : PubMed

            

    Title: Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42
    Chen XH, Koumoutsi A, Scholz R, Eisenreich A, Schneider K, Heinemeyer I, Morgenstern B, Voss B, Hess WR and Borriss R <9 more author(s)>
    Ref: Nat Biotechnol, 25:1007, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer