Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: baca3-w4qrq6

Bacillus akibai (strain ATCC 43226 / DSM 21942 / JCM 9157 / 1139). Uncharacterized protein

Relationship
Family|Abhydrolase_7
Block| X
Position in NCBI Life Tree|Bacillus akibai
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus akibai: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BAUV01000011, WP_052013030
1 UniProt : W4QRQ6
1 UniProt : W4QRQ6
1 Interpro : W4QRQ6
1 Prodom : W4QRQ6
1 Pfam : W4QRQ6
1 PIRSF : W4QRQ6
1 SUPERFAM : W4QRQ6
Sequence
Graphical view for this peptide sequence: baca3-w4qrq6
Colored MSA for Abhydrolase_7 (raw)
MWSPDSFLNQLYNEVVYTHVQTYDLEWKKKLKSRLDEVLGDFTSVKVEGQ
SEILEMVEQEEYVRLRVLLTTGTSLKMPLYVLLPKMKAQEKRPAVLALHG
HGYGSREIVGLHPGGLNNKGDPGIHRNFAVELVKKGVVVVAPELIGFGDR
KLKGDQHAESAHANSCFQIASHLLLLNKTLAGLRVFECRRVLDYMESLVE
IDFEKIGCMGLSGGGLVAAFTAALDDRIKATVVSGYANTFKGSVLSRKHC
LDNYLPGILQYAELPELIGLISPRKLFIEAGVNVHLFPEQEVEVALITLR
EIYKSDNAEQALYSHFFDGGHEICGDRSFDWLVNALGKSTNYRGSYKEEN
K
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWSPDSFLNQLYNEVVYTHVQTYDLEWKKKLKSRLDEVLGDFTSVKVEGQ
SEILEMVEQEEYVRLRVLLTTGTSLKMPLYVLLPKMKAQEKRPAVLALHG
HGYGSREIVGLHPGGLNNKGDPGIHRNFAVELVKKGVVVVAPELIGFGDR
KLKGDQHAESAHANSCFQIASHLLLLNKTLAGLRVFECRRVLDYMESLVE
IDFEKIGCMGLSGGGLVAAFTAALDDRIKATVVSGYANTFKGSVLSRKHC
LDNYLPGILQYAELPELIGLISPRKLFIEAGVNVHLFPEQEVEVALITLR
EIYKSDNAEQALYSHFFDGGHEICGDRSFDWLVNALGKSTNYRGSYKEEN
K


Reference
    Title: Draft Genome Sequences of Three Alkaliphilic Bacillus Strains, Bacillus wakoensis JCM 9140T, Bacillus akibai JCM 9157T, and Bacillus hemicellulosilyticus JCM 9152T
    Yuki M, Oshima K, Suda W, Oshida Y, Kitamura K, Iida T, Hattori M, Ohkuma M
    Ref: Genome Announc, 2:, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer