Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacam-q70k06

Bacillus amyloliquefaciens hypothetical protein

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Bacillus amyloliquefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus amyloliquefaciens group: N E > Bacillus amyloliquefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ576102
1 UniProt : Q70K06
1 UniProt : Q70K06
1 Interpro : Q70K06
1 Prodom : Q70K06
1 Pfam : Q70K06
1 PIRSF : Q70K06
1 SUPERFAM : Q70K06
Sequence
Graphical view for this peptide sequence: bacam-q70k06
Colored MSA for PAF-Acetylhydrolase (raw)
MKSVYSAMCVFHIRHFYYVRGNKRMKKYDAFPEPIGGYTVGRTQMDFEYT
ASDHTKRELTAFVYYPSDSSEGKTTSTYMFPEVCEMLDEQPLLSALKDAY
SIDIKTQCYDDLALSGKEKRYPVLFYVCGGGGSPEWGTVICTDLASMGYV
LVSIGHQNSTMYKRKDGRLFNVSKDFSGVIMAFSEDPEMLALAGKMEMRP
DDETAIEMCQNVLTLPILDKLTEYSELQAEDVRYVADYLVKLDSGELNSI
FKDRLLLDIGMGIVGHSYGGATTAIVCRDDERFACGIGLDSGAFGLQGSD
LKKPFLLLFSEPNYNMNAIIGANNSMDTYYFSVDRAAHLDYCDIVFTSVN
EELRGERDAMEMRNLVTDYTKNFFDHYILQKAASVESLAYDGVDLIKKTS
NK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKSVYSAMCVFHIRHFYYVRGNKRMKKYDAFPEPIGGYTVGRTQMDFEYT
ASDHTKRELTAFVYYPSDSSEGKTTSTYMFPEVCEMLDEQPLLSALKDAY
SIDIKTQCYDDLALSGKEKRYPVLFYVCGGGGSPEWGTVICTDLASMGYV
LVSIGHQNSTMYKRKDGRLFNVSKDFSGVIMAFSEDPEMLALAGKMEMRP
DDETAIEMCQNVLTLPILDKLTEYSELQAEDVRYVADYLVKLDSGELNSI
FKDRLLLDIGMGIVGHSYGGATTAIVCRDDERFACGIGLDSGAFGLQGSD
LKKPFLLLFSEPNYNMNAIIGANNSMDTYYFSVDRAAHLDYCDIVFTSVN
EELRGERDAMEMRNLVTDYTKNFFDHYILQKAASVESLAYDGVDLIKKTS
NK


Reference
    Title: Structural and functional characterization of gene clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42
    Koumoutsi A, Chen XH, Henne A, Liesegang H, Hitzeroth G, Franke P, Vater J, Borriss R
    Ref: Journal of Bacteriology, 186:1084, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer