Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA2687

Bacillus anthracis (strain Ames) hydrolase, and Bacillus cereus (strain ATCC 10987) alpha/beta fold family

Comment
Bacillus cereus Q737C8 and Q737C7 short sequences of Bacillus cereus (strain ATCC 10987) hydrolase Rasko et al


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3OOS: The structure of an alpha/beta fold family hydrolase from Bacillus anthracis str. Sterne
No kinetic





No Substrate
No inhibitor
2 Genbank : AE017032, AE017272
2 UniProt : Q737C8, Q737C7
1 Structure : 3OOS
3 UniProt : Q81PV7, Q737C8, Q737C7
3 Interpro : Q81PV7, Q737C8, Q737C7
3 Pfam : Q81PV7, Q737C8, Q737C7
3 PIRSF : Q81PV7, Q737C8, Q737C7
3 SUPERFAM : Q81PV7, Q737C8, Q737C7
Sequence
Graphical view for this peptide sequence: bacan-BA2687
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MWTTNIIKTPRGKFEYFLKGEGPPLCVTHLYSEYNDNGNTFANPFTDHYS
VYLVNLKGCGNSDSAKNDSEYSMTETIKDLEAIREALYINKWGFAGHSAG
GMLALVYATEAQESLTKIIVGGAAASKEYASHKDSIYCSKNVKFNRIVSI
MNALNDDSTVQEERKALSREWALMSFYSEEKLEEALKLPNSGKTVGNRLN
YFRQVEYKDYDVRQKLKFVKIPSFIYCGKHDVQCPYIFSCEIANLIPNAT
LTKFEESNHNPFVEEIDKFNQFVNDTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWTTNIIKTPRGKFEYFLKGEGPPLCVTHLYSEYNDNGNTFANPFTDHYS
VYLVNLKGCGNSDSAKNDSEYSMTETIKDLEAIREALYINKWGFAGHSAG
GMLALVYATEAQESLTKIIVGGAAASKEYASHKDSIYCSKNVKFNRIVSI
MNALNDDSTVQEERKALSREWALMSFYSEEKLEEALKLPNSGKTVGNRLN
YFRQVEYKDYDVRQKLKFVKIPSFIYCGKHDVQCPYIFSCEIANLIPNAT
LTKFEESNHNPFVEEIDKFNQFVNDTL


References
    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer