Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA2738

Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, hydrolase, alpha/beta fold family

Comment
Other strains: Bacillus anthracis (strains Ames; A0442; A0174; A0465; CDC 684 / NRRL 3495; A0488; A0193; A0389; Tsiankovskii-I; A0248) Bacillus thuringiensis serovars (pondicheriensis BGSC 4BA1; andalousiensis BGSC 4AW1) Bacillus cereus (95/8201; AH820)


Relationship
Family|Aclacinomycin-methylesterase_RdmC
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bacan-BA2738
Colored MSA for Aclacinomycin-methylesterase_RdmC (raw)
MTEKIFKINGIDICTESFGNPKNPAILLIMGATCSMIYWDEEFCERLANS
GKFVIRFDNRDVGRSVAYEPGTSNYTVTDMAEDAIGVLDAYHINKAHLFG
MSLGGMIAQIAAVKHPERVLTLTLLATSIIGSDNNTRDLPPMDERILTHH
ANGKHLDWTNENVVAEYLVSGSRLLCGSKRTFDEIRVYNQVKQEMERANN
LLSMFNHALLQGDDAYEGVLHSIQAPTLVIHGTDDTALPFEHGLALIDEI
PNSVLLTLEGAGHENHPDDWENIVHAVTEHTAKIIDK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTEKIFKINGIDICTESFGNPKNPAILLIMGATCSMIYWDEEFCERLANS
GKFVIRFDNRDVGRSVAYEPGTSNYTVTDMAEDAIGVLDAYHINKAHLFG
MSLGGMIAQIAAVKHPERVLTLTLLATSIIGSDNNTRDLPPMDERILTHH
ANGKHLDWTNENVVAEYLVSGSRLLCGSKRTFDEIRVYNQVKQEMERANN
LLSMFNHALLQGDDAYEGVLHSIQAPTLVIHGTDDTALPFEHGLALIDEI
PNSVLLTLEGAGHENHPDDWENIVHAVTEHTAKIIDK


Reference
    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer