Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA4324

Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, hydrolase

Comment
Other strains: Bacillus anthracis (strain Ames; A0442; A0248; A0174; CDC 684 / NRRL 3495; A0389; A0193; A0465; A0488; Tsiankovskii-I; CI; H9401; UR-1; A16; 8903-G; 9080-G; 52-G; CZC5; SVA11; BF1) Bacillus thuringiensis (subsp. konkukian; serovar tochigiensis BGSC 4Y1; serovar andalousiensis BGSC 4AW1; Al Hakam; monterrey BGSC 4AJ1; pondicheriensis BGSC 4BA1; pulsiensis BGSC 4CC1) Bacillus cereus (strains ATCC 10987;ATCC 4342; Rock3-42; 95/8201; AH820; NVH0597-99; W; 03BB108; BGSC 6E1; 03BB102; F837/76; ISP3191) Q6HE63 AE017355 for Bacillus thuringiensis Q731J5 AE017277 for Bacillus cereus


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bacan-BA4324
Colored MSA for Proline_iminopeptidase (raw)
MLFRSYTPQFYNENKQPIPNSIATMESVMINNRKQTLLIRGQNVEQPILL
CCHGGPGMAQIGFIRHFQKELEKHFIVINWDQRGAGKSFSTKDFGANFTI
EQFISDAKEVIQYVLKKFSKQKLFLAGHSWGSIIGLNIAHQYPQYIEAYI
GIGQIVHMKQNEELLYQHLIRSAKKHDHKKALASLLKLGKPPFLDTRRLI
IQRKWLGTFGGAIQNGSSFSFIRKGFFSPEYTLLDWFKFLAGNLKSGVLW
EEMLTIDFFSSITSLSIPVYFCSGRYDYQTPYALVQEYCDVIEAPIKKMI
WFPNSAHSPDLEEPELFAHSLQSIKQELAFQH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLFRSYTPQFYNENKQPIPNSIATMESVMINNRKQTLLIRGQNVEQPILL
CCHGGPGMAQIGFIRHFQKELEKHFIVINWDQRGAGKSFSTKDFGANFTI
EQFISDAKEVIQYVLKKFSKQKLFLAGHSWGSIIGLNIAHQYPQYIEAYI
GIGQIVHMKQNEELLYQHLIRSAKKHDHKKALASLLKLGKPPFLDTRRLI
IQRKWLGTFGGAIQNGSSFSFIRKGFFSPEYTLLDWFKFLAGNLKSGVLW
EEMLTIDFFSSITSLSIPVYFCSGRYDYQTPYALVQEYCDVIEAPIKKMI
WFPNSAHSPDLEEPELFAHSLQSIKQELAFQH


References
7 more
    Title: The complete genome sequence of Bacillus thuringiensis Al Hakam
    Challacombe JF, Altherr MR, Xie G, Bhotika SS, Brown N, Bruce D, Campbell CS, Campbell ML, Chen J and Brettin TS <38 more author(s)>
    Ref: Journal of Bacteriology, 189:3680, 2007 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer