Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA5009

Bacillus anthracis, Bacillus cereus, Bacillus thuringiensis, Bacillus weihenstephanensis lysophospholipase l2 (EC 3.1.1.5)

Comment
Other strains: Bacillus anthracis (strain Ames; A0442; Tsiankovskii-I; A0193; A0174; A0248; CDC 684 / NRRL 3495; A0465; A0488; A0389 ) Bacillus cereus (strains ATCC 10987; NVH0597-99; m1293;BGSC 6E1; 03BB108; 95/8201; Rock3-42; 03BB102; AH820; W; AH1271; MM3; Rock4-2; F65185; B4264; BDRD-Cer4; BDRD-ST24; Rock4-18; Rock3-28; ATCC 4342; Q1; BDRD-ST26 ; H3081.97; AH187; R309803; SJ1; var. anthracis (strain CI)) Bacillus thuringiensis (subsp. konkukian; Al Hakam; serovars pulsiensis BGSC 4CC1; monterrey BGSC 4AJ1; kurstaki str. T03a001; thuringiensis str. T01001; berliner ATCC 10792; Bt407; tochigiensis BGSC 4Y1; chinensis CT-43; subsp. finitimus (strain YBT-020); BMB171) Bacillus weihenstephanensis (KBAB4) lysophospholipase l2 (EC 3.1.1.5) Q81KI8 Q6HRZ0 Bacillus anthracis Q72YW6 Bacillus cereus Q6HCC2 Bacillus thuringiensis


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 47 more: AE017279, AE017039, AE017355
>3 UniProt links 16 more: Q72YW6, Q6HCC2, A9VLB8
>3 UniProt links 17 more: Q81KI8, Q72YW6, Q6HCC2
>3 Interpro links 17 more: Q81KI8, Q72YW6, Q6HCC2
>3 Pfam links 17 more: Q81KI8, Q72YW6, Q6HCC2
>3 PIRSF links 17 more: Q81KI8, Q72YW6, Q6HCC2
>3 SUPERFAM links 17 more: Q81KI8, Q72YW6, Q6HCC2
Sequence
Graphical view for this peptide sequence: bacan-BA5009
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGT
TSRNRGHIDSFDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQE
TKREDVDGIILSSPCLGVLAGPSAPLQAASKILNIIAPKLQFATNLTVEM
STRNHEVRDAMENDSLFLRKVSVRWYSELIKSIEIAHKKIDDFPDVPLLL
MQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLNEYERDEILNY
IQSFTEIRINNIIETNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGT
TSRNRGHIDSFDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQE
TKREDVDGIILSSPCLGVLAGPSAPLQAASKILNIIAPKLQFATNLTVEM
STRNHEVRDAMENDSLFLRKVSVRWYSELIKSIEIAHKKIDDFPDVPLLL
MQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLNEYERDEILNY
IQSFTEIRINNIIETNK


References
6 more
    Title: Extending the Bacillus cereus group genomics to putative food-borne pathogens of different toxicity
    Lapidus A, Goltsman E, Auger S, Galleron N, Segurens B, Dossat C, Land ML, Broussolle V, Brillard J and Sorokin A <8 more author(s)>
    Ref: Chemico-Biological Interactions, 171:236, 2008 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer