Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacbr-grsb

Bacillus brevis (Brevibacillus brevis)(and Aneurinibacillus migulanus) atp-dependent leucine adenylase (leua)activase Thioesterase domain (gramicidin s synthetase 2)

Comment
Aneurinibacillus migulanus Brevibacillus brevis


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Bacillus brevis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Paenibacillaceae: N E > Brevibacillus: N E > Brevibacillus brevis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: X61658, M29703, X15577
2 UniProt : P0C064, P0C063
1 UniProt : P0C064
1 Interpro : P0C064
1 Prodom : P0C064
1 Pfam : P0C064
1 PIRSF : P0C064
1 SUPERFAM : P0C064
Sequence
Graphical view for this peptide sequence: bacbr-grsb
Colored MSA for Thioesterase (raw)
EMPLNVVFKHSTIMKIAEYITHQESENNVHQPILVNVEADREALSLNGEK
QRKNIELPILLNEETDRNVFLFAPIGAQGVFYKKLAEQIPTASLYGFDFI
EDDDRIQQYIESMIQTQSDGQYVLIGYSSGGNLAFEVAKEMERQGYSVSD
LVLFDVYWKGKVFEQTKEEEEENIKIIMEELRENPGMFNMTREDFELYFA
NEFVKQSFTRKMRKYMSFYTQLVNYGEVEATIHLIQAEFEEEKIDENEKA
DEEEKTYLEEKWNEKAWNKAAKRFVKYNGYGAHSNMLGGDGLERNSSILK
QILQGTFVVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EMPLNVVFKHSTIMKIAEYITHQESENNVHQPILVNVEADREALSLNGEK
QRKNIELPILLNEETDRNVFLFAPIGAQGVFYKKLAEQIPTASLYGFDFI
EDDDRIQQYIESMIQTQSDGQYVLIGYSSGGNLAFEVAKEMERQGYSVSD
LVLFDVYWKGKVFEQTKEEEEENIKIIMEELRENPGMFNMTREDFELYFA
NEFVKQSFTRKMRKYMSFYTQLVNYGEVEATIHLIQAEFEEEKIDENEKA
DEEEKTYLEEKWNEKAWNKAAKRFVKYNGYGAHSNMLGGDGLERNSSILK
QILQGTFVVK


References
2 more
    Title: Four homologous domains in the primary structure of GrsB are related to domains in a superfamily of adenylate-forming enzymes
    Turgay K, Krause M, Marahiel MA
    Ref: Molecular Microbiology, 6:529, 1992 : PubMed

            

    Title: The nucleotide sequence for a proline-activating domain of gramicidin S synthetase 2 gene from Bacillus brevis
    Hori K, Yamamoto Y, Tokita K, Saito F, Kurotsu T, Kanda M, Okamura K, Furuyama J, Saito Y
    Ref: J Biochem, 110:111, 1991 : PubMed

            

    Title: Gramicidin S biosynthesis operon containing the structural genes grsA and grsB has an open reading frame encoding a protein homologous to fatty acid thioesterases
    Kratzschmar J, Krause M, Marahiel MA
    Ref: Journal of Bacteriology, 171:5422, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer