Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacc1-q730c7

Bacillus cereus (strain ATCC 10987) Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 Putative uncharacterized protein

Relationship
Family|HNLyase_Bact
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE017194, ACNJ01000087
1 UniProt : Q730C7
1 UniProt : Q730C7
1 Interpro : Q730C7
1 Pfam : Q730C7
1 PIRSF : Q730C7
1 SUPERFAM : Q730C7
Sequence
Graphical view for this peptide sequence: bacc1-q730c7
Colored MSA for HNLyase_Bact (raw)
METFVLVHGAWDGGYVWKKLAKLLREEGHSVYTPTLTGLGERTHLMQPNI
GLKTFIQDIVNTIKYESLRDVILVGHSYSGMVITGVAEEIPEFIKELVYV
DAMLPENGDSVMDISGPEMAAHFIEEVKVYGEGWRVLPRNTIDEKKSAMS
LLAFTQSVEIKNSKAQLIPHIYVEVKDNPEHWPMTPIFLESAKKARDRKW
EVFSIEVGGHWVMETNPEALVRILNQCVEVV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METFVLVHGAWDGGYVWKKLAKLLREEGHSVYTPTLTGLGERTHLMQPNI
GLKTFIQDIVNTIKYESLRDVILVGHSYSGMVITGVAEEIPEFIKELVYV
DAMLPENGDSVMDISGPEMAAHFIEEVKVYGEGWRVLPRNTIDEKKSAMS
LLAFTQSVEIKNSKAQLIPHIYVEVKDNPEHWPMTPIFLESAKKARDRKW
EVFSIEVGGHWVMETNPEALVRILNQCVEVV


Reference
    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer