Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacc1-q735c5

Bacillus cereus (strain ATCC 10987) (and strain G9241) nad-dependent epimerase/dehydratase / alpha/beta hydrolase

Comment
only c-term PfamA Abhydrolase_1 408 464


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE017274, AAEK01000001
1 UniProt : Q735C5
1 UniProt : Q735C5
1 Interpro : Q735C5
1 Pfam : Q735C5
1 PIRSF : Q735C5
1 SUPERFAM : Q735C5
Sequence
Graphical view for this peptide sequence: bacc1-q735c5
Colored MSA for 6_AlphaBeta_hydrolase (raw)
EDLFPLAQELHEKTGQPVWILDLPGLGRSPFKRENNLLDIYLNVVKKLLE
KATNGAHLIGHSFGAFILLEALVQEYMDKKYAITLLQPPVAKKNAKSLNV
PQFMNKWILKLATTNLIGRYLLSNGLFESMESIPEHYIEKISNSFTSPRI
LNTTVQLNSLLLKHDQGDFNGVTKYNLHIIWGDHDRGYSAPSHLGKVDFV
PYGHHFPLSHPSETATLVIKNSNTSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EDLFPLAQELHEKTGQPVWILDLPGLGRSPFKRENNLLDIYLNVVKKLLE
KATNGAHLIGHSFGAFILLEALVQEYMDKKYAITLLQPPVAKKNAKSLNV
PQFMNKWILKLATTNLIGRYLLSNGLFESMESIPEHYIEKISNSFTSPRI
LNTTVQLNSLLLKHDQGDFNGVTKYNLHIIWGDHDRGYSAPSHLGKVDFV
PYGHHFPLSHPSETATLVIKNSNTSI


References
    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer