Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC0192

Bacillus cereus, Bacillus thuringiensis, Bacillus weihenstephanensis, Bacillus anthracis, Bacillus mycoides, acylamino-acid-releasing enzyme (EC 3.4.19.1)

Comment
Other strains: Bacillus cereus (strains: ATCC 14579 / DSM 31; ATCC 10987; G9241; AH1271; ZK; Rock4-2; m1550; 03BB102; ATCC 10876; W; BDRD-Cer4; AH820; NVH0597-99; ATCC 14579 / DSM 31; 172560W; AH1134; F65185; B4264; Rock3-42; 03BB108; BGSC 6E1; var. anthracis CI; AH676; 95/8201; Rock1-15; BDRD-ST24; G9842; AH187; m1293; BDRD-ST26; Q1; AH603; BDRD-ST196; Rock3-29; Rock1-3; AH1273; AH1272; Rock4-18; AH621), Bacillus anthracis (strains: Ames; A0248; A0465; CDC 684 / NRRL 3495; A0442; A0389; A0193; A0488; Tsiankovskii-I; A0174), Bacillus thuringiensis (strains: serovars ( israelensis ATCC 35646; monterrey BGSC 4AJ1; pondicheriensis BGSC 4BA1; kurstaki str. T03a001; huazhongensis BGSC 4BD1; andalousiensis BGSC 4AW1; pulsiensis BGSC 4CC1; pakistani T13001; chinensis CT-43; thuringiensis T01001; sotto T04001; berliner ATCC 10792); subsp. konkukian; IBL 200; BMB171; Al Hakam; IBL 4222; Bt407), Bacillus weihenstephanensis KBAB4, Bacillus mycoides DSM 2048


Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: AE016998, AAJM01000004, AE017264
>3 UniProt links 34 more: Q3F0Q8, Q73F16, C2YKW1
>3 UniProt links 34 more: Q81J00, Q3F0Q8, Q73F16
>3 Interpro links 34 more: Q81J00, Q3F0Q8, Q73F16
>3 Prodom links 34 more: Q81J00, Q3F0Q8, Q73F16
>3 Pfam links 34 more: Q81J00, Q3F0Q8, Q73F16
>3 PIRSF links 34 more: Q81J00, Q3F0Q8, Q73F16
>3 SUPERFAM links 34 more: Q81J00, Q3F0Q8, Q73F16
Sequence
Graphical view for this peptide sequence: bacce-BC0192
Colored MSA for ACPH_Peptidase_S9 (raw)
MMKVNEKTYLSIEEIISLPTVSSTNISDDGKNVAFVKKTADWKDNTYRNH
VWIYEKDKKQSYPLSNGDIDSTHPLWSPDARCIAYLSPVGDGKNQIFVKS
LDGYREVQITDEKEGVSTFKWGPTGKGLYYVTQSKECEEIKKRKDLYGDF
QHIGKEHQNNCLYYIEIEKVIQSDTDEHKNRVVYQLTDGKDFHIHEFDIS
NDGKKVVFMATPSSNMADYINGDLYILHIKAGELQKLNVDKLLGGSVCFS
PDGSEICYTASIREKGYYRNHIQDSTLEIYDINTGELIQPLTDFDSTVMP
LQWTAKGVLIRWQNKTNYLIGLLAEDGTVEILSEKVDGFIMDASITKDGK
HISYNKAITNETFEIYLDDKKITDENSFFKGKLRSNREIISWKSSDGLEI
EGVLSTPVELDNNKKYPLLVVIHGGPAWASFPIFSDCFNEKYPIEQFVEK
GFIVLEPNYRGSSGYGNEFLKANYRKQGIADYDDVISGVDELVEKGMVDK
DRVGVMGWSNGGYVSAFCSTFSSRFKAISVGGGITNWSTHYVNTDIPYFI
RMYLGNTPWNDPEIYTKTSPMTYIKSACTPTLIQHGEKDARIPITNAYDL
YQGLMDMEVDTELIIFKGMAYSSDQPGVHVAIMKQNLMWFSHYILGESME
GFRTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKVNEKTYLSIEEIISLPTVSSTNISDDGKNVAFVKKTADWKDNTYRNH
VWIYEKDKKQSYPLSNGDIDSTHPLWSPDARCIAYLSPVGDGKNQIFVKS
LDGYREVQITDEKEGVSTFKWGPTGKGLYYVTQSKECEEIKKRKDLYGDF
QHIGKEHQNNCLYYIEIEKVIQSDTDEHKNRVVYQLTDGKDFHIHEFDIS
NDGKKVVFMATPSSNMADYINGDLYILHIKAGELQKLNVDKLLGGSVCFS
PDGSEICYTASIREKGYYRNHIQDSTLEIYDINTGELIQPLTDFDSTVMP
LQWTAKGVLIRWQNKTNYLIGLLAEDGTVEILSEKVDGFIMDASITKDGK
HISYNKAITNETFEIYLDDKKITDENSFFKGKLRSNREIISWKSSDGLEI
EGVLSTPVELDNNKKYPLLVVIHGGPAWASFPIFSDCFNEKYPIEQFVEK
GFIVLEPNYRGSSGYGNEFLKANYRKQGIADYDDVISGVDELVEKGMVDK
DRVGVMGWSNGGYVSAFCSTFSSRFKAISVGGGITNWSTHYVNTDIPYFI
RMYLGNTPWNDPEIYTKTSPMTYIKSACTPTLIQHGEKDARIPITNAYDL
YQGLMDMEVDTELIIFKGMAYSSDQPGVHVAIMKQNLMWFSHYILGESME
GFRTL


References
8 more
    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            

    Title: Genome sequence of Bacillus cereus and comparative analysis with Bacillus anthracis.
    Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova N and Kyrpides N <13 more author(s)>
    Ref: Nature, 423:87, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer