Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC1813

Bacillus cereus (strain ATCC 14579 / DSM 31) Bacillus thuringiensis serovar israelensis ATCC 35646 carboxylic ester hydrolase (EC 3.1.1.-)

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE017003, AAJM01000748
1 UniProt : Q3EJN8
2 UniProt : Q81EZ5, Q3EJN8
2 Interpro : Q81EZ5, Q3EJN8
2 Prodom : Q81EZ5, Q3EJN8
2 Pfam : Q81EZ5, Q3EJN8
2 PIRSF : Q81EZ5, Q3EJN8
2 SUPERFAM : Q81EZ5, Q3EJN8
Sequence
Graphical view for this peptide sequence: bacce-BC1813
Colored MSA for PAF-Acetylhydrolase (raw)
MNFWEVVLIVVNFSLLSWILLIGRETKKWSKLATLIAVVMVTVQLLAEGF
RWQMIPAYVSPVILILCYLLAGRKKGFRSSGIFIVKTSLLCIYLSVAVAL
PLLMPVFSFEEPTGPHRVGTKLYHWVDHQRNEPYSKNPNDRRELMVQIWY
PAAEKSKGDPEPYIRNINELSKGLEKTLSIPAFAFSHMELVKSHSFMDLQ
LSDSENHYPILLFSHGFNGFRNQNTFQVEELASQGYIVLSIDHTFDAAAT
VFPGGRTAYVQPINLTDEGDSHIKLWEEDVSFVLNQIEKLNENDETGFFT
GRLDTSRIGMFGHSYGGATAAQILAKDSRVKAAINMDGTLYGEILPESGI
GKPFLLMNAEEPDEADPFEVRERYGRGLAGGGMSMVIPHTDHTSFTDLHL
FSPLLQSPGENPKEVHRIINEFSLAFFDQYVKQKDDGSTLKRLITQYPEV
NFKINR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFWEVVLIVVNFSLLSWILLIGRETKKWSKLATLIAVVMVTVQLLAEGF
RWQMIPAYVSPVILILCYLLAGRKKGFRSSGIFIVKTSLLCIYLSVAVAL
PLLMPVFSFEEPTGPHRVGTKLYHWVDHQRNEPYSKNPNDRRELMVQIWY
PAAEKSKGDPEPYIRNINELSKGLEKTLSIPAFAFSHMELVKSHSFMDLQ
LSDSENHYPILLFSHGFNGFRNQNTFQVEELASQGYIVLSIDHTFDAAAT
VFPGGRTAYVQPINLTDEGDSHIKLWEEDVSFVLNQIEKLNENDETGFFT
GRLDTSRIGMFGHSYGGATAAQILAKDSRVKAAINMDGTLYGEILPESGI
GKPFLLMNAEEPDEADPFEVRERYGRGLAGGGMSMVIPHTDHTSFTDLHL
FSPLLQSPGENPKEVHRIINEFSLAFFDQYVKQKDDGSTLKRLITQYPEV
NFKINR



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer