Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC3734

Bacillus cereus, Bacillus thuringiensis, Bacillus cereus, Bacillus mycoides IROE protein

Comment
Other strains: Bacillus cereus (strain ATCC 14579 / DSM 31) Bacillus thuringiensis (serovars israelensis ATCC 35646; berliner ATCC 10792; Bt407; thuringiensis T01001; pakistani T13001; IBL 4222; sotto T04001; kurstaki T03a001; kurstaki T03a001; IBL 200) Bacillus cereus (strains BDRD-Cer4; BDRD-ST24; AH676; Rock4-2; F65185; 172560W; AH1134; ATCC 10876) Bacillus mycoides (DSM 2048; B4264; Rock1-15; G9842; AH603; Rock3-28; m1550; Rock1-3; Rock3-29; R309803)


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
2QM0: Crystal structure of BES (IroE) protein from Bacillus cereus
No kinetic





No Substrate
1 inhbitor:
DFP
>3 Genbank links 25 more: AE017010, AAJM01000051, ACNF01000086
>3 UniProt links 11 more: Q3EWX1, C2T4I7, C2P279
1 Structure : 2QM0
>3 UniProt links 12 more: Q81A57, Q3EWX1, C2T4I7
>3 Interpro links 12 more: Q81A57, Q3EWX1, C2T4I7
>3 Prodom links 12 more: Q81A57, Q3EWX1, C2T4I7
>3 Pfam links 12 more: Q81A57, Q3EWX1, C2T4I7
>3 PIRSF links 12 more: Q81A57, Q3EWX1, C2T4I7
>3 SUPERFAM links 12 more: Q81A57, Q3EWX1, C2T4I7
Sequence
Graphical view for this peptide sequence: bacce-BC3734
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MNTTVEKQQIITSNTEQWKMYSKLEGKEYQIHISKPKQPAPDSGYPVIYV
LDGNAFFQTFHEAVKIQSVRAEKTGVSPAIIVGVGYPIEGAFSGEERCYD
FTPSVISKDAPLKPDGKPWPKTGGAHNFFTFIEEELKPQIEKNFEIDKGK
QTLFGHSLGGLFALHILFTNLNAFQNYFISSPSIWWNNKSVLEKEENLII
ELNNAKFETGVFLTVGSLEREHMVVGANELSERLLQVNHDKLKFKFYEAE
GENHASVVPTSLSKGLRFISYV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNTTVEKQQIITSNTEQWKMYSKLEGKEYQIHISKPKQPAPDSGYPVIYV
LDGNAFFQTFHEAVKIQSVRAEKTGVSPAIIVGVGYPIEGAFSGEERCYD
FTPSVISKDAPLKPDGKPWPKTGGAHNFFTFIEEELKPQIEKNFEIDKGK
QTLFGHSLGGLFALHILFTNLNAFQNYFISSPSIWWNNKSVLEKEENLII
ELNNAKFETGVFLTVGSLEREHMVVGANELSERLLQVNHDKLKFKFYEAE
GENHASVVPTSLSKGLRFISYV



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer