Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-q72yu1

Bacillus cereus, Bacillus thuringiensis, Bacillus anthracis, Bacillus weihenstephanensis, Bacillus mycoides, non-heme chloroperoxidase arylesterase (EC 1.11.1.10)

Comment
Other strains: Bacillus cereus (strains ATCC 4342; H3081.97; AH187; Q1; G9241; ATCC 10987; ZK; AH1271; NVH0597-99; AH820; 03BB108 03BB102; ATCC 14579 / DSM 31; AH1273; AH1272; AH603; AH621; BDRD-ST196; Rock1-3; AH1134; ATCC 10876; BDRD-ST24; m1550; B4264; BDRD-Cer4; 172560W; AH676; Rock1-15; G9842; Rock4-2; F65185; Rock3-42; m1293; BDRD-ST26; BGSC 6E1; 95/8201; MM3; R309803; Rock3-29; Rock3-28) Bacillus thuringiensis (strains IBL 4222; IBL 200; Bt407; serovars: israelensis ATCC 35646; thuringiensis T01001; berliner ATCC 10792; sotto T04001; huazhongensis BGSC 4BD1; pakistani T13001; kurstaki T03a001; pondicheriensis BGSC 4BA1, andalousiensis BGSC 4AW, tochigiensis BGSC 4Y1, monterrey BGSC 4AJ1, pulsiensis BGSC 4CC1; subsp. finitimus (strain YBT-020) subsp. konkukian; Al Hakam), Bacillus anthracis (strains Ames; A0442; A0389; Tsiankovskii-I; A0488; A0193; CDC 684 / NRRL 3495; A0465; A0174; A0248) Bacillus weihenstephanensis KBAB4 Bacillus mycoides DSM 2048 Bacillus thuringiensis


Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 52 more: AE017279, CP000001, ACMR01000184
>3 UniProt links 31 more: Q632R2, Q72YU1, C2YY08
>3 UniProt links 33 more: Q632R2, Q72YU1, C2YY08
>3 Interpro links 33 more: Q632R2, Q72YU1, C2YY08
>3 Pfam links 33 more: Q632R2, Q72YU1, C2YY08
>3 PIRSF links 33 more: Q632R2, Q72YU1, C2YY08
>3 SUPERFAM links 33 more: Q632R2, Q72YU1, C2YY08
Sequence
Graphical view for this peptide sequence: bacce-q72yu1
Colored MSA for Haloperoxidase (raw)
MFVTVEKDVHIFVQDVNPGPSSKTVFFFHSWPLNHQMYQYQLNVLPQHGF
RCIAMDIRGNGQSDKPWTGYTYDRLADDIAIVLEALQVENATLVGFSVGG
ALSIRYMSRYNGQRISKLVLIDAVSPSFVKNQESPYGVPKEQADTLINQM
YANLPKFLNDLSLSFFNRNLGSATLEWFSYLGMQSASYALIKILQAAANE
DVTKDLSKINVPTKIFHGIHDQLIPYKSAELTQKRIKNSQLHPLTNSGHG
SPIDQADELNEELIKFLHS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFVTVEKDVHIFVQDVNPGPSSKTVFFFHSWPLNHQMYQYQLNVLPQHGF
RCIAMDIRGNGQSDKPWTGYTYDRLADDIAIVLEALQVENATLVGFSVGG
ALSIRYMSRYNGQRISKLVLIDAVSPSFVKNQESPYGVPKEQADTLINQM
YANLPKFLNDLSLSFFNRNLGSATLEWFSYLGMQSASYALIKILQAAANE
DVTKDLSKINVPTKIFHGIHDQLIPYKSAELTQKRIKNSQLHPLTNSGHG
SPIDQADELNEELIKFLHS


References
6 more
    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer