Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacdo-ACHE

Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis) Bactrocera cucurbitae (Melon fruit fly) acetylcholinesterase

Comment
Other strains: Bactrocera cucurbitae Dacus cucurbitae, Chaetodacus latifrons, Dacus oleae


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Bactrocera dorsalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Tephritoidea: N E > Tephritidae: N E > Dacinae: N E > Dacini: N E > Bactrocera [genus]: N E > Bactrocera [subgenus]: N E > Bactrocera dorsalis complex: N E > Bactrocera dorsalis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
4 mutations: Table (e.g. : G488S, I214V/G488S/Q643R, I214V ... more)
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 10 more: AJ517506, AY183672, AB096610
>3 UniProt links 4 more: Q5QT18, Q5KTT3, H6D9M7
2 Ncbi-nid : 56292094, 37731410
2 Ncbi-pid : 56292095, 37731411
>3 UniProt links 9 more: Q5QT18, Q5KTT3, H6D9M7
>3 Interpro links 9 more: Q5QT18, Q5KTT3, H6D9M7
>3 Prodom links 9 more: Q5QT18, Q5KTT3, H6D9M7
>3 Pfam links 9 more: Q5QT18, Q5KTT3, H6D9M7
>3 PIRSF links 9 more: Q5QT18, Q5KTT3, H6D9M7
>3 SUPERFAM links 9 more: Q5QT18, Q5KTT3, H6D9M7
Sequence
Graphical view for this peptide sequence: bacdo-ACHE
Colored MSA for ACHE (raw)
MAHTTSLLSGASSAAASPLSSRQYSVASSPRLSGDIGRGLFAIVVLLLRM
SSVYGVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPLDDLRFR
KPVPAEPWHGVLDATRLPATCVQERYEYFPGFSGEEIWNPNTNVSEDCLY
INVWAPAKARLRHGRGANGGEHSNKADTDHLIHNGNPQNTTNGLPVLIWI
YGGGFMTGTATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLSPAMPGY
EEEAPGNVGLWDQALAIRWLKTNAHAFGGNPEWMTLFGESAGSSSVNAQL
VSPVTAGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLS
ENPQAVMACMRAVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPDHPMKM
METADLRGYDILMGNVRDEGTYFLLYDFIDYFDKDEATSLPRDKYLEIMN
NIFGKVTQAEREAIIFRHTSWVGNPGLENQQQIGRAVGDHFFTCPTNEYA
QALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQY
RQVERELGKRMLNAVIEFAKTGNPATDGEEWPNFTKKDPVYYVFSTDDKE
EKLQRGPLEGRCAFWNEYLREVRKWGSQCELKPSSASSLQQKQQHLLLQQ
RSIVTFMLTLSLVLGIPSVNAFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAHTTSLLSGASSAAASPLSSRQYSVASSPRLSGDIGRGLFAIVVLLLRM
SSVYGVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPLDDLRFR
KPVPAEPWHGVLDATRLPATCVQERYEYFPGFSGEEIWNPNTNVSEDCLY
INVWAPAKARLRHGRGANGGEHSNKADTDHLIHNGNPQNTTNGLPVLIWI
YGGGFMTGTATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLSPAMPGY
EEEAPGNVGLWDQALAIRWLKTNAHAFGGNPEWMTLFGESAGSSSVNAQL
VSPVTAGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLS
ENPQAVMACMRAVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPDHPMKM
METADLRGYDILMGNVRDEGTYFLLYDFIDYFDKDEATSLPRDKYLEIMN
NIFGKVTQAEREAIIFRHTSWVGNPGLENQQQIGRAVGDHFFTCPTNEYA
QALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQY
RQVERELGKRMLNAVIEFAKTGNPATDGEEWPNFTKKDPVYYVFSTDDKE
EKLQRGPLEGRCAFWNEYLREVRKWGSQCELKPSSASSLQQKQQHLLLQQ
RSIVTFMLTLSLVLGIPSVNAFF


References
    Title: Biochemical and molecular characterisation of acetylcholinesterase in four field populations of Bactrocera dorsalis (Hendel) (Diptera: Tephritidae)
    Shen GM, Wang XN, Dou W, Wang JJ
    Ref: Pest Manag Sci, 68:1553, 2012 : PubMed

            

    Title: Mutations in the acetylcholinesterase gene of Bactrocera dorsalis associated with resistance to organophosphorus insecticides
    Hsu JC, Haymer DS, Wu WJ, Feng HT
    Ref: Insect Biochemistry & Molecular Biology, 36:396, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer