bacld-Q65L73

 
Bacillus licheniformis (strain DSM 13 / ATCC 14580) conserved protein, putative carbohydrate esterase family 1, yjch

Relationship
Block X
Bacillus licheniformis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : CP000002
1 UniProt : Q65L73
1 UniProtTrembl : Q65L73
1 Interpro : Q65L73
1 Prodom : Q65L73
1 Pfam : Q65L73
1 PIRSF : Q65L73
1 SUPERFAM : Q65L73
1 QuickSwissBlast : Q65L73
 
Sequence
Graphical view for this peptide sequence: bacld-Q65L73
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MKTGVIQEKKLFSEELGEEMELLVYLPSSFSPLYKYHVIIAQDGHDYFRL
GRISRQVEELLANGEIERSIIIGIPYKNVQERRLTYHPEGSKFEAYKRFL
ANELVPFTDREYPTYQVGSGRTLIGDSLGGTVSLMTALDYPNMFGNVIMQ
SPYVDRHVLDKVKQSDSLQLISICHQIGEKETAVKTTDDQILDFTGPNEQ
LKELLESKQTNYDFKAFDGDHKWTYWQPLITPALKKML
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTGVIQEKKLFSEELGEEMELLVYLPSSFSPLYKYHVIIAQDGHDYFRL
GRISRQVEELLANGEIERSIIIGIPYKNVQERRLTYHPEGSKFEAYKRFL
ANELVPFTDREYPTYQVGSGRTLIGDSLGGTVSLMTALDYPNMFGNVIMQ
SPYVDRHVLDKVKQSDSLQLISICHQIGEKETAVKTTDDQILDFTGPNEQ
LKELLESKQTNYDFKAFDGDHKWTYWQPLITPALKKML

no DNA




Reference
    Title: Complete genome sequence of the industrial bacterium Bacillus licheniformis and comparisons with closely related Bacillus species
    Rey MW, Ramaiya P, Nelson BA, Brody-Karpin SD, Zaretsky EJ, Tang M, Lopez de Leon A, Xiang H, Gusti V and Berka RM <11 more author(s)>
    Ref: Genome Biol, 5:R77, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer