bacld-q65eq1

 
Bacillus licheniformis, Bacillus amyloliquefaciens (Bacillus velezensis); Bacillus sonorensis, Lipase Lip_vut5 from Goat Rumen metagenome, YvaK BL28, BlEst1

Comment
Other strains: Bacillus licheniformis (DSM 13 / ATCC 14580; S 16; CG-B52; 9945A; Bacillus amyloliquefaciens (Bacillus velezensis); Bacillus sonorensis L12


Relationship
Block X
Bacillus licheniformis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6NKG: Crystal Structure of the Bacillus licheniformis Lipase Lip_vut5 from Goat Rumen metagenome.
No kinetic



>3 Genbank links 9 more: CP000002, AE017333, KY478994
>3 UniProt links 1 more: Q65EQ1, W7RUH5, T5HB30
1 Structure : 6NKG
>3 UniProtTrembl links 1 more: Q65EQ1, W7RUH5, T5HB30
>3 Interpro links 1 more: Q65EQ1, W7RUH5, T5HB30
>3 Prodom links 1 more: Q65EQ1, W7RUH5, T5HB30
>3 Pfam links 1 more: Q65EQ1, W7RUH5, T5HB30
>3 PIRSF links 1 more: Q65EQ1, W7RUH5, T5HB30
>3 SUPERFAM links 1 more: Q65EQ1, W7RUH5, T5HB30
>3 QuickSwissBlast links 1 more: Q65EQ1, W7RUH5, T5HB30
 
Sequence
Graphical view for this peptide sequence: bacld-q65eq1
Colored MSA for CarbLipBact_1 (raw)
MKIVKPQPFTFKGGKKAVLLLHGFTGNTADVRMLGRYLNEKGYTCHAPQY
KGHGVPPEELLSTGPEDWWKDVMDGYEYLKSEGYEQIAACGLSLGGVFSL
KLGYTVPIKGIVPMCAPMYIKSEETMYEGVLDYARNYKKFEGKTAEQINA
EMEEFKKTPMNTLKALQDLIADVREHVDMIYSPTFVVQARHDHMINTDSA
NIIYNEVETDDKQLKWYEESGHAITLDKERETLHKDVYQFLETLDWQT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKIVKPQPFTFKGGKKAVLLLHGFTGNTADVRMLGRYLNEKGYTCHAPQY
KGHGVPPEELLSTGPEDWWKDVMDGYEYLKSEGYEQIAACGLSLGGVFSL
KLGYTVPIKGIVPMCAPMYIKSEETMYEGVLDYARNYKKFEGKTAEQINA
EMEEFKKTPMNTLKALQDLIADVREHVDMIYSPTFVVQARHDHMINTDSA
NIIYNEVETDDKQLKWYEESGHAITLDKERETLHKDVYQFLETLDWQT

no DNA




References
6 more
    Title: Characterization of a novel deep-sea microbial esterase EstC10 and its use in the generation of (R)-methyl2-chloropropionate
    Gong Y, Ma S, Wang Y, Xu Y, Sun A, Zhang Y, Hu Y
    Ref: J Ocean Limnol, 36:473, 2018 : PubMed

            

    Title: Low-resolution envelope, biophysical analysis and biochemical characterization of a short-chain specific and halotolerant carboxylesterase from Bacillus licheniformis
    Nakamura AM, Kadowaki MAS, Godoy A, Nascimento AS, Polikarpov I
    Ref: Int J Biol Macromol, 120:1893, 2018 : PubMed

            

    Title: The complete genome sequence of Bacillus licheniformis DSM13, an organism with great industrial potential
    Veith B, Herzberg C, Steckel S, Feesche J, Maurer KH, Ehrenreich P, Baumer S, Henne A, Liesegang H and Gottschalk G <2 more author(s)>
    Ref: J Molecular Microbiology Biotechnol, 7:204, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer