bacld-q65mg8

 
Bacillus licheniformis (strain DSM 13 / ATCC 14580) hypothetical protein

Relationship
Block X
Bacillus licheniformis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AE017333, CP000002
1 UniProt : Q65MG8
1 UniProtTrembl : Q65MG8
1 Interpro : Q65MG8
1 Prodom : Q65MG8
1 Pfam : Q65MG8
1 PIRSF : Q65MG8
1 SUPERFAM : Q65MG8
1 QuickSwissBlast : Q65MG8
 
Sequence
Graphical view for this peptide sequence: bacld-q65mg8
Colored MSA for AlphaBeta_hydrolase (raw)
MWIGILLMVSGIGISIFAVSLIVSYLFVLPNRSTYEETFFSGLKHGEIID
DVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIISHGIKWSLFGGYK
YVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFG
KDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAA
VKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLLIIHGTKDQL
VPPEMAKSLYERKKGFKKLYWIEGAGHVGGFRHNPEEYLNKIKDFILKIE
PAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWIGILLMVSGIGISIFAVSLIVSYLFVLPNRSTYEETFFSGLKHGEIID
DVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIISHGIKWSLFGGYK
YVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFG
KDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAA
VKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLLIIHGTKDQL
VPPEMAKSLYERKKGFKKLYWIEGAGHVGGFRHNPEEYLNKIKDFILKIE
PAN

no DNA




References
    Title: Complete genome sequence of the industrial bacterium Bacillus licheniformis and comparisons with closely related Bacillus species
    Rey MW, Ramaiya P, Nelson BA, Brody-Karpin SD, Zaretsky EJ, Tang M, Lopez de Leon A, Xiang H, Gusti V and Berka RM <11 more author(s)>
    Ref: Genome Biol, 5:R77, 2004 : PubMed

            

    Title: The complete genome sequence of Bacillus licheniformis DSM13, an organism with great industrial potential
    Veith B, Herzberg C, Steckel S, Feesche J, Maurer KH, Ehrenreich P, Baumer S, Henne A, Liesegang H and Gottschalk G <2 more author(s)>
    Ref: J Molecular Microbiology Biotechnol, 7:204, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer