bacli-LICTE

 
Bacillus licheniformis thioesterase

Relationship
Block X
Bacillus licheniformis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : U95370, AJ005061
2 UniProt : O66072, O69248
2 UniProtTrembl : O66072, O69248
2 Interpro : O66072, O69248
2 Prodom : O66072, O69248
2 Pfam : O66072, O69248
2 PIRSF : O66072, O69248
2 SUPERFAM : O66072, O69248
2 QuickSwissBlast : O66072, O69248
 
Sequence
Graphical view for this peptide sequence: bacli-LICTE
Colored MSA for Thioesterase (raw)
MNEIIKQFGAPAGGTQLICFPFAGGYSASFGPLYEHLKADFEVLAIEPPG
HGTIEWRLSTSDNLRRLVDLYIAALKPRLSAPFVLFGHSMGGMVVYRLTQ
KLEQEGIFPAAAVISAIQPPHIQRQKVSHKNDDAFLDHLIQLGGIPQQLK
DNREVMNFFLPSFRADYRALETFCHTDHTPLMSPVHILNGDRDEKCMKDA
HGWKKWARTIDFHYFKGGHMYLLAKTEQVAAKIKTIAAASRKEAPPGNIK
KNGKSVC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNEIIKQFGAPAGGTQLICFPFAGGYSASFGPLYEHLKADFEVLAIEPPG
HGTIEWRLSTSDNLRRLVDLYIAALKPRLSAPFVLFGHSMGGMVVYRLTQ
KLEQEGIFPAAAVISAIQPPHIQRQKVSHKNDDAFLDHLIQLGGIPQQLK
DNREVMNFFLPSFRADYRALETFCHTDHTPLMSPVHILNGDRDEKCMKDA
HGWKKWARTIDFHYFKGGHMYLLAKTEQVAAKIKTIAAASRKEAPPGNIK
KNGKSVC

no DNA




References
    Title: Molecular and biochemical characterization of the protein template controlling biosynthesis of the lipopeptide lichenysin.
    Konz D, Doekel S, Marahiel MA
    Ref: Journal of Bacteriology, 181:133, 1999 : PubMed

            

    Title: A putative lichenysin A synthetase operon in B.licheniformis: initial charachterization.
    Yakimov MM, Kroeger A, Slepak TN, Giuliano L, Timmis KN, Golyshin PN
    Ref: Biochimica & Biophysica Acta, 1399:141, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer