bacli-LICTE
Bacillus licheniformis thioesterase
Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
6_AlphaBeta_hydrolase :
bacld-q65hn8 Bacillus licheniformis (strain DSM 13 / ATCC 14580) yqjl ,
bacld-q65j72 Bacillus licheniformis (strain DSM 13 / ATCC 14580) YdjC .
A85-IroE-IroD-Fes-Yiel :
bacld-Q65L73 Bacillus licheniformis (strain DSM 13 / ATCC 14580) conserved protein, putative carbohydrate esterase family 1, yjch ,
bacld-q62yz9 Bacillus licheniformis (strain DSM 13 / ATCC 14580) putative carbohydrate esterase, family 1, ybba ,
bacld-q65dz7 Bacillus licheniformis (strain DSM 13 / ATCC 14580) yuii (putative esterase) .
Abhydrolase_7 :
bacld-q65fy2 Bacillus licheniformis (strain DSM 13 / ATCC 14580) putative endopeptidase ytap .
Acetyl-esterase_deacetylase :
bacld-q65nm7 Bacillus licheniformis, Bacillus sp.Cephalosporin C deacetylase Cah .
ACPH_Peptidase_S9 :
bacld-q65fc5 Bacillus licheniformis (strain DSM 13 / ATCC 14580) putative acylaminoacyl-peptidase yuxl .
Acyl-CoA_Thioesterase :
bacld-q65ly2 Bacillus licheniformis (strain DSM 13 / ATCC 14580) hypothetical protein (EC 3.1.2.2) .
AlphaBeta_hydrolase :
bacld-q65mg8 Bacillus licheniformis (strain DSM 13 / ATCC 14580) hypothetical protein .
Bacillus_lip :
bacld-q65le0 Bacillus licheniformis (strain DSM 13 / ATCC 14580). yjau (hypothetical protein) .
BD-FAE :
bacld-q65fg3 Bacillus licheniformis; Bacillus sonorensis Lip_vut4 from Goat Rumen metagenome (esterase/lipase/thioesterase),
bacld-q65gx2 Bacillus licheniformis (strain DSM 13 / ATCC 14580) esterase b) .
BlEst2-lipase-like :
bacld-q65fg2 Bacillus licheniformis lipase BlEst2 (EC 3.1.1.3).
CarbLipBact_1 :
bacld-q65eq1 Bacillus licheniformis, Bacillus amyloliquefaciens (Bacillus velezensis); Bacillus sonorensis, Lipase Lip_vut5 from Goat Rumen metagenome, YvaK BL28, BlEst1.
CarbLipBact_2 :
bacld-q65n63 Bacillus licheniformis, Bacillus sp., Bacillus amyloliquefaciens (Bacillus velezensis) hypothetical protein (esterase/lipase/thioesterase) .
Carbon-carbon_bond_hydrolase :
bacld-q65fk9 Bacillus licheniformis (strain DSM 13 / ATCC 14580) putative hydrolase yugf .
Carb_B_Bacteria :
bacld-q65my7 Bacillus licheniformis; Bacillus sp.; Bacillus amyloliquefaciens, pnba (para-nitrobenzyl esterase) (intracellular esterase b) ,
bacli-Q93LA4 Bacillus licheniformis carboxylesterase (EC 3.1.1.1) .
Haloperoxidase :
bacld-q62u01 Bacillus licheniformis (strain DSM 13 / ATCC 14580) (strain DSM 13 / ATCC 14580) esterase/lipase/thioesterase family protein yisy .
Lipase_2 :
bacld-q65hr4 Bacillus licheniformis; Bacillus sp. Lipase Lip_vut1 from Goat Rumen metagenome lip (lipase).
LYsophospholipase_carboxylesterase :
bacld-q65if8 Bacillus licheniformis (strain DSM 13 / ATCC 14580) yodd (phospholipase/carboxylesterase family protein) .
MenH_SHCHC :
bacld-q65ft3 Bacillus licheniformis (strain DSM 13 / ATCC 14580; WX-02) Bacillus sp. BT1B_CT2 ytxm o-succinylbenzoate synthase .
Monoglyceridelipase_lysophospholip :
bacld-q65fw3 Bacillus licheniformis (strain DSM 13 / ATCC 14580) Bacillus sp. BT1B_CT2 probable lysophospholipase ytpa .
PAF-Acetylhydrolase :
bacld-q65iy4 Bacillus licheniformis, Bacillus atrophaeus, Geobacillus sp., hypothetical protein (putative choline esterase) .
PC-sterol_acyltransferase :
bacli-EST Bacillus licheniformis esterase (EC 3.1.1.1) .
Prolyl_oligopeptidase_S9 :
bacld-q65m29 Bacillus licheniformis (strain DSM 13 / ATCC 14580) Bacillus sp. BT1B_CT2 hypothetical protein (putative amine dehydrogenase) .
Thioesterase :
bacld-q65e02 Bacillus licheniformis (strain DSM 13 / ATCC 14580) dhbf ,
bacld-q65nk2 Bacillus licheniformis (strain DSM 13 / ATCC 14580) lichenysin synthetase d (thioesterase lchad) ,
bacli-bacc Bacillus licheniformis Bacillus subtilis Thioesterase domain ,
bacli-BACT Bacillus licheniformis Bacillus subtilis thioesterase II-like protein ,
bacli-BTST Bacillus licheniformis putative thioesterase ,
bacli-LICC Bacillus licheniformis; Bacillus amyloliquefaciens; Bacillus paralicheniformis, LCHAC lichenysin synthetase c Thioesterase domain Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can
retrieve all strain data
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.Bacillus licheniformis LMG 7559:
N ,
E .
Bacillus licheniformis DSM 13 = ATCC 14580:
N ,
E .
Bacillus licheniformis WX-02:
N ,
E .
Bacillus licheniformis CG-B52:
N ,
E .
Bacillus licheniformis S 16:
N ,
E .
Bacillus licheniformis ATCC 14580:
N ,
E .
Molecular evidence
Database
No mutation No structure No kinetic
Sequence
Graphical view for this peptide sequence: bacli-LICTE Colored MSA for Thioesterase (raw)
MNEIIKQFGAPAGGTQLICFPFAGGYSASFGPLYEHLKADFEVLAIEPPG
HGTIEWRLSTSDNLRRLVDLYIAALKPRLSAPFVLFGHSMGGMVVYRLTQ
KLEQEGIFPAAAVISAIQPPHIQRQKVSHKNDDAFLDHLIQLGGIPQQLK
DNREVMNFFLPSFRADYRALETFCHTDHTPLMSPVHILNGDRDEKCMKDA
HGWKKWARTIDFHYFKGGHMYLLAKTEQVAAKIKTIAAASRKEAPPGNIK
KNGKSVC
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M N E I I K Q F G A P A G G T Q L I C F P F A G G Y S A S F G P L Y E H L K A D F E V L A I E P P G H G T I E W R L S T S D N L R R L V D L Y I A A L K P R L S A P F V L F G H S M G G M V V Y R L T Q K L E Q E G I F P A A A V I S A I Q P P H I Q R Q K V S H K N D D A F L D H L I Q L G G I P Q Q L K D N R E V M N F F L P S F R A D Y R A L E T F C H T D H T P L M S P V H I L N G D R D E K C M K D A H G W K K W A R T I D F H Y F K G G H M Y L L A K T E Q V A A K I K T I A A A S R K E A P P G N I K K N G K S V C no DNA
References
Title: Molecular and biochemical characterization of the protein template controlling biosynthesis of the lipopeptide lichenysin.
Konz D , Doekel S , Marahiel MA
Ref: Journal of Bacteriology, 181 :133, 1999 : PubMed Abstract
         Title: A putative lichenysin A synthetase operon in B.licheniformis: initial charachterization.
Yakimov MM , Kroeger A , Slepak TN , Giuliano L , Timmis KN , Golyshin PN
Ref: Biochimica & Biophysica Acta, 1399 :141, 1998 : PubMed Abstract
         Other Papers