Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacli-Q93LA4

Bacillus licheniformis carboxylesterase (EC 3.1.1.1)

Comment
Other strains: Bacillus licheniformis Bacillus sonorensis L12


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Bacillus licheniformis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AJ315954, AOFM01000005
1 UniProt : M5PFN6
2 UniProt : Q93LA4, M5PFN6
2 Interpro : Q93LA4, M5PFN6
2 Prodom : Q93LA4, M5PFN6
2 Pfam : Q93LA4, M5PFN6
2 PIRSF : Q93LA4, M5PFN6
2 SUPERFAM : Q93LA4, M5PFN6
Sequence
Graphical view for this peptide sequence: bacli-Q93LA4
Colored MSA for Carb_B_Bacteria (raw)
MSGLTVKTRYGALKGTMQNGVRVWKGIPYAKPPVGKWRFKAPQETDAWEG
VRDATQFGSICPQPEGILFQLERVEKSEDCLCLNVFAPQSSGENRPVMVW
IHGGAFYLGAGSEPLYDGSHLAADGDVIVATINYRLGPFGFLHLSSVNQS
YSNNLGLLDQIAALKWVKENISSFGGDPDNITVFGESAGSMSIASLLAMP
DAKGLFQKAIMQSGASETMPKEKAETAAETFLHILNIDPDHSEQLHDVSA
KELLEAADELRDVMGENIFQLLFLPVVDRETLPLEPVTAVAQGAADDIKL
LIGTNRDEGVLFFTPESELLPEQKKAEILREHVGGELAKTAAELYPGSLE
GQINMMTDILFWRPAVAFAAGQSAHSPVWMYRFDWHSEHPPFHKAAHGLD
IPFVFGNMDALDMITNTKASEETKQLSQHIPGLPGFHLHIREVRPLKPSA
GRTMIRTHEKRSFSNTTILIEEDPDAEKRKKLKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSGLTVKTRYGALKGTMQNGVRVWKGIPYAKPPVGKWRFKAPQETDAWEG
VRDATQFGSICPQPEGILFQLERVEKSEDCLCLNVFAPQSSGENRPVMVW
IHGGAFYLGAGSEPLYDGSHLAADGDVIVATINYRLGPFGFLHLSSVNQS
YSNNLGLLDQIAALKWVKENISSFGGDPDNITVFGESAGSMSIASLLAMP
DAKGLFQKAIMQSGASETMPKEKAETAAETFLHILNIDPDHSEQLHDVSA
KELLEAADELRDVMGENIFQLLFLPVVDRETLPLEPVTAVAQGAADDIKL
LIGTNRDEGVLFFTPESELLPEQKKAEILREHVGGELAKTAAELYPGSLE
GQINMMTDILFWRPAVAFAAGQSAHSPVWMYRFDWHSEHPPFHKAAHGLD
IPFVFGNMDALDMITNTKASEETKQLSQHIPGLPGFHLHIREVRPLKPSA
GRTMIRTHEKRSFSNTTILIEEDPDAEKRKKLKI


References
    Title: Draft Whole-Genome Sequence of Bacillus sonorensis Strain L12, a Source of Nonribosomal Lipopeptides
    Adimpong DB, Sorensen KI, Nielsen DS, Thorsen L, Rasmussen TB, Derkx PM, Jespersen L
    Ref: Genome Announc, 1:e0009713, 2013 : PubMed

            

    Title: Development of a versatile cassette for directional genome walking using cassette ligation-mediated PCR and its application in the cloning of complete lipolytic genes from Bacillus species
    Nthangeni MB, Ramagoma F, Tlou MG, Litthauer D
    Ref: J Microbiol Methods, 61:225, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer