Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacmb-a0a0b6amr7

Bacillus megaterium (strain ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / VKM B-512). Chlorophyllase enzyme family protein

Relationship
Family|UCP031982
Block| X
Position in NCBI Life Tree|Bacillus megaterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus megaterium: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP009920, WP_034649869
1 UniProt : A0A0B6AMR7
1 UniProt : A0A0B6AMR7
1 Interpro : A0A0B6AMR7
1 Prodom : A0A0B6AMR7
1 Pfam : A0A0B6AMR7
1 PIRSF : A0A0B6AMR7
1 SUPERFAM : A0A0B6AMR7
Sequence
Graphical view for this peptide sequence: bacmb-a0a0b6amr7
Colored MSA for UCP031982 (raw)
MHIRKHERQAFYAGCQFVDMEDDGNEHGFPLLIMYPTYQEEQVEKMGPYT
ISAAQDAPLSNGSFPLVIISHGDGSTPLVYRTIAQFLARNGFIVGVPQHP
FNNRENNTLSGTIDNLKNRPNHIRTIIDWFLKESSFSPSIKSNNISLIGH
SMGGYTALAVAGGVPNSFPSESPDQKPYCLSVDHDKRVQSLILLAPATGW
FREKGALEDVNIPILMITGEKDTITPSFHGEFVLNGVSDPEKVQHIVVEN
GGHFSFLSPFPDFMKSPSFLPSQDPEDFNRKEFHEDLQNTILNFLLHSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHIRKHERQAFYAGCQFVDMEDDGNEHGFPLLIMYPTYQEEQVEKMGPYT
ISAAQDAPLSNGSFPLVIISHGDGSTPLVYRTIAQFLARNGFIVGVPQHP
FNNRENNTLSGTIDNLKNRPNHIRTIIDWFLKESSFSPSIKSNNISLIGH
SMGGYTALAVAGGVPNSFPSESPDQKPYCLSVDHDKRVQSLILLAPATGW
FREKGALEDVNIPILMITGEKDTITPSFHGEFVLNGVSDPEKVQHIVVEN
GGHFSFLSPFPDFMKSPSFLPSQDPEDFNRKEFHEDLQNTILNFLLHSF


Reference
    Title: Finished Genome Sequence of Bacillus cereus Strain 03BB87, a Clinical Isolate with B. anthracis Virulence Genes
    Johnson SL, Minogue TD, Teshima H, Davenport KW, Shea AA, Miner HL, Wolcott MJ, Chain PS
    Ref: Genome Announc, 3:, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer