Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacme-PHAC

Bacillus megaterium pha synthase phac

Comment
Other strains: Bacillus megaterium (strains DSM 319; ATCC 12872 / QMB1551), Bacillus sp. C19


Relationship
Family|PHA_synth_III_C
Block| X
Position in NCBI Life Tree|Bacillus megaterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus megaterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF109909
>3 UniProt links 2 more: Q9ZF92, D5DCX8, D5DZA0
>3 UniProt links 2 more: Q9ZF92, D5DCX8, D5DZA0
>3 Interpro links 2 more: Q9ZF92, D5DCX8, D5DZA0
>3 Prodom links 2 more: Q9ZF92, D5DCX8, D5DZA0
>3 Pfam links 2 more: Q9ZF92, D5DCX8, D5DZA0
>3 PIRSF links 2 more: Q9ZF92, D5DCX8, D5DZA0
>3 SUPERFAM links 2 more: Q9ZF92, D5DCX8, D5DZA0
Sequence
Graphical view for this peptide sequence: bacme-PHAC
Colored MSA for PHA_synth_III_C (raw)
MAIPYVQEWEKLIKSMPSEYKSSARRFKRAYEIMTTEAEPEVGLTPKEVI
WKKNKAKLYRYTPVKDNLHKTPILLVYALINKPYILDLTPGNSLVEYLLN
RGFDVYLLDWGTPGLEDSNMKLDDYIVDYIPKAAKKVLRTSKSPDLSVLG
YCMGGTMTSIFAALNEDLPIKNLIFMTSPFDFSDTGLYGAFLDDRYFNLD
KAVDTFGNIPPEMIDFGNKMLKPITNFYGPYVTLVDRSENQRFVESWKLM
QKWVADGIPFAGEAYRQWIRDFYQQNKLINGELEVRGRKVDLKNIKANIL
NIAASRDHIAMPHQVAALMDAVSSEDKEYKLLQTGHVSVVFGPKAVKETY
PSIGDWLEKRSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIPYVQEWEKLIKSMPSEYKSSARRFKRAYEIMTTEAEPEVGLTPKEVI
WKKNKAKLYRYTPVKDNLHKTPILLVYALINKPYILDLTPGNSLVEYLLN
RGFDVYLLDWGTPGLEDSNMKLDDYIVDYIPKAAKKVLRTSKSPDLSVLG
YCMGGTMTSIFAALNEDLPIKNLIFMTSPFDFSDTGLYGAFLDDRYFNLD
KAVDTFGNIPPEMIDFGNKMLKPITNFYGPYVTLVDRSENQRFVESWKLM
QKWVADGIPFAGEAYRQWIRDFYQQNKLINGELEVRGRKVDLKNIKANIL
NIAASRDHIAMPHQVAALMDAVSSEDKEYKLLQTGHVSVVFGPKAVKETY
PSIGDWLEKRSK


References
    Title: PhaC and PhaR are required for polyhydroxyalkanoic acid synthase activity in Bacillus megaterium
    McCool GJ, Cannon MC
    Ref: Journal of Bacteriology, 183:4235, 2001 : PubMed

            

    Title: Polyhydroxyalkanoate inclusion body-associated proteins and coding region in Bacillus megaterium
    McCool GJ, Cannon MC
    Ref: Journal of Bacteriology, 181:585, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer