Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacme-a0a0h4r706

Bacillus megaterium; Bacillus sp. Accessory Sec system protein Asp2

Comment
only c-term Asp2 n-term Hepar_II_III Other strains: Bacillus megaterium Q3; Bacillus sp.


Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Bacillus megaterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus megaterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: CP010586, WP_049163399, WP_057241644
1 UniProt : A0A0Q9I023
1 Interpro : A0A0Q9I023
1 Prodom : A0A0Q9I023
1 Pfam : A0A0Q9I023
1 PIRSF : A0A0Q9I023
1 SUPERFAM : A0A0Q9I023
Sequence
Graphical view for this peptide sequence: bacme-a0a0h4r706
Colored MSA for Asp2 (raw)
MNGVKYHFVPAADETLQDKLVIVFSALANKYHYVYNYMKTLDEVGANKLF
ILDDFGEQGSYYLGKNRNHVIETSVSSLIQYIMSKHGFTHKNVMTVGSSK
GGYAALYYGIKYHFGQVIAGAPQSKLGDFLIDQAEHVNIAEYISGSDNVN
KEYLNQILFNLLDQPVDSAPDIRLYVGTWDYHHKSHVLPLYHQLKDRGYK
VTLDLEDRANHKDLKGYFPLYLGRTISEILDVQYVEHVPFKIKRALLKDN
KSYFIARCDTEGHGNLEYAYYIYKDDKIVHKTSYIEEEIFRYKPRAKGEY
RCRIFVRNQYKQKAVRDTNSVFI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNGVKYHFVPAADETLQDKLVIVFSALANKYHYVYNYMKTLDEVGANKLF
ILDDFGEQGSYYLGKNRNHVIETSVSSLIQYIMSKHGFTHKNVMTVGSSK
GGYAALYYGIKYHFGQVIAGAPQSKLGDFLIDQAEHVNIAEYISGSDNVN
KEYLNQILFNLLDQPVDSAPDIRLYVGTWDYHHKSHVLPLYHQLKDRGYK
VTLDLEDRANHKDLKGYFPLYLGRTISEILDVQYVEHVPFKIKRALLKDN
KSYFIARCDTEGHGNLEYAYYIYKDDKIVHKTSYIEEEIFRYKPRAKGEY
RCRIFVRNQYKQKAVRDTNSVFI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer