Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacme-g9bex6

Bacillus megaterium Soluble epoxide hydrolase

Comment
Other strains: Bacillus megaterium (strains ATCC 12872 / QMB1551; WSH-002; DSM 319; ECU1001)


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus megaterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus megaterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 4INZ, 4IO0, 4NZZ... more)
No kinetic





1 substrate:
Glycidyl-1-naphthyl-ether
2 inhibitors: (R)-3-[1]naphthyloxy-propane-1,2-diol, 2-Phenoxyacetamide
>3 Genbank links 2 more: HQ436037, CP001983, CP003017
3 UniProt : G9BEX6, D5DVX8, D5DHV1
>3 Structure links 1 more: 4NZZ, 4O08, 4INZ
3 UniProt : G9BEX6, D5DVX8, D5DHV1
3 Interpro : G9BEX6, D5DVX8, D5DHV1
3 Prodom : G9BEX6, D5DVX8, D5DHV1
3 Pfam : G9BEX6, D5DVX8, D5DHV1
3 PIRSF : G9BEX6, D5DVX8, D5DHV1
3 SUPERFAM : G9BEX6, D5DVX8, D5DHV1
Sequence
Graphical view for this peptide sequence: bacme-g9bex6
Colored MSA for Epoxide_hydrolase (raw)
GSHMASMTGGQQMGRGSMSKQYINVNGVNLHYISKGQGELMLFLHGFPDF
SHIWRHQIDEFSNDFHTVALDLRGYNLSEKPSGLESYEIDVLVEDIRQVI
EGLGYSSCTLVVHDWGAGIGWTFAYRYPEYVQKLIAFNGPHPYTFMRELR
TNKNQQKASEYAKWFQKQEVQDYMERDNFSGLRKLVIDPGVKKGYLTADD
VQAYMNSWENGSVLSMLSYYRNLKIFTEEDLRRKSLFPLEEEVLNIPVQI
IWGNQDPTFMPENLDGIEEYVPNISVHRLAEASHAPQHEKPQEVNNVMWN
FLNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GSHMASMTGGQQMGRGSMSKQYINVNGVNLHYISKGQGELMLFLHGFPDF
SHIWRHQIDEFSNDFHTVALDLRGYNLSEKPSGLESYEIDVLVEDIRQVI
EGLGYSSCTLVVHDWGAGIGWTFAYRYPEYVQKLIAFNGPHPYTFMRELR
TNKNQQKASEYAKWFQKQEVQDYMERDNFSGLRKLVIDPGVKKGYLTADD
VQAYMNSWENGSVLSMLSYYRNLKIFTEEDLRRKSLFPLEEEVLNIPVQI
IWGNQDPTFMPENLDGIEEYVPNISVHRLAEASHAPQHEKPQEVNNVMWN
FLNK


References
    Title: Engineering of an epoxide hydrolase for efficient bioresolution of bulky pharmaco substrates
    Kong XD, Yuan S, Li L, Chen S, Xu JH, Zhou J
    Ref: Proc Natl Acad Sci U S A, 111:15717, 2014 : PubMed

            

    Title: Complete genome sequence of the industrial strain Bacillus megaterium WSH-002
    Liu L, Li Y, Zhang J, Zou W, Zhou Z, Liu J, Li X, Wang L, Chen J
    Ref: Journal of Bacteriology, 193:6389, 2011 : PubMed

            

    Title: Improved catalytic performance of Bacillus megaterium epoxide hydrolase in a medium containing Tween-80
    Gong PF, Xu JH, Tang YF, Wu HY
    Ref: Biotechnol Prog, 19:652, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer