Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacmy-c3b9b8

Bacillus mycoides, Bacillus pseudomycoides, Bacillus cereus Lysophospholipase L2

Comment
Other strains: Bacillus mycoides (Rock3-17; Rock1-4) , Bacillus pseudomycoides DSM 12442, Bacillus cereus Rock3-44


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Bacillus mycoides Rock3-17
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus mycoides: N E > Bacillus mycoides Rock3-17: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: ACMW01000094, ACMX01000076, ACMV01000234
3 UniProt : C3BRD7, C3AS12, C2WDE6
3 UniProt : C3BRD7, C3AS12, C2WDE6
3 Interpro : C3BRD7, C3AS12, C2WDE6
3 Prodom : C3BRD7, C3AS12, C2WDE6
3 Pfam : C3BRD7, C3AS12, C2WDE6
3 PIRSF : C3BRD7, C3AS12, C2WDE6
3 SUPERFAM : C3BRD7, C3AS12, C2WDE6
Sequence
Graphical view for this peptide sequence: bacmy-c3b9b8
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MYQIKEKSEMEEFRMWNYEAEAAKAVIVMVHGAMEYHGRYEALAEMWNHF
GYHVVMGDLPAHGTTSRNRGHIDSFDEYIEEIKLWVKEARKYRLPIFLFG
HSMGGLIVIRMMEETKRDDIDGIILSSPCLGVLAVPAAPLRAVSKVLNIL
TPKLQFPTKLTVNMSTRNKEVRDAMENDSLFLRKVSVRWYSELIKSIEIA
HDKIDEFPDVPLLLMQACEDKIVDKTRVRKWFDNLNISDKAYKEWSNCYH
ELLNEYEQDEILNYIKSFTEIHVNNIIETNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYQIKEKSEMEEFRMWNYEAEAAKAVIVMVHGAMEYHGRYEALAEMWNHF
GYHVVMGDLPAHGTTSRNRGHIDSFDEYIEEIKLWVKEARKYRLPIFLFG
HSMGGLIVIRMMEETKRDDIDGIILSSPCLGVLAVPAAPLRAVSKVLNIL
TPKLQFPTKLTVNMSTRNKEVRDAMENDSLFLRKVSVRWYSELIKSIEIA
HDKIDEFPDVPLLLMQACEDKIVDKTRVRKWFDNLNISDKAYKEWSNCYH
ELLNEYEQDEILNYIKSFTEIHVNNIIETNK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer