Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacpu-AXE

Bacillus pumilus (Bacillus mesentericus) (strain SAFR-032; ATCC 7061) acetyl xylan esterase (EC 3.1.1.6)

Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Bacillus pumilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus pumilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
6 structures (e.g. : 2XLB, 2XLC, 3FVR... more)
No kinetic





No Substrate
1 inhbitor:
Paraoxon
3 Genbank : AJ249957, CP000813, ABRX01000003
1 UniProt : A8F9S7
>3 Structure links 3 more: 2XLB, 2XLC, 3FVT
2 UniProt : Q9K5F2, A8F9S7
2 Interpro : Q9K5F2, A8F9S7
2 Prodom : Q9K5F2, A8F9S7
2 Pfam : Q9K5F2, A8F9S7
2 PIRSF : Q9K5F2, A8F9S7
2 SUPERFAM : Q9K5F2, A8F9S7
Sequence
Graphical view for this peptide sequence: bacpu-AXE
Colored MSA for Acetyl-esterase_deacetylase (raw)
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYP
VKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIH
DIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYCY
RGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVV
VADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDL
INLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEF
IPAFQTEKLSFLQKHLLLST
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYP
VKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIH
DIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYCY
RGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVV
VADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDL
INLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEF
IPAFQTEKLSFLQKHLLLST


References
2 more
    Title: Heterologous expression, purification, crystallization, X-ray analysis and phasing of the acetyl xylan esterase from Bacillus pumilus
    Krastanova I, Guarnaccia C, Zahariev S, Degrassi G, Lamba D
    Ref: Biochimica & Biophysica Acta, 1748:222, 2005 : PubMed

            

    Title: The acetyl xylan esterase of Bacillus pumilus belongs to a family of esterases with broad substrate specificity
    Degrassi G, Kojic M, Ljubijankic G, Venturi V
    Ref: Microbiology, 146 ( Pt 7):1585, 2000 : PubMed

            

    Title: Purification and characterization of an acetyl xylan esterase from Bacillus pumilus
    Degrassi G, Okeke BC, Bruschi CV, Venturi V
    Ref: Applied Environmental Microbiology, 64:789, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer