Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacpu-w8fke7

Bacillus pumilus (Bacillus mesentericus) Lipase

Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Bacillus pumilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus pumilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7R1K, 7R25
No kinetic





1 substrate:
4-Methylumbelliferyl-butyrate
1 inhbitor:
Paraoxon
2 Genbank : AHK05790, WP_065098612
1 UniProt : W8FKE7
2 Structure : 7R1K, 7R25
1 UniProt : W8FKE7
1 Interpro : W8FKE7
1 Prodom : W8FKE7
1 Pfam : W8FKE7
1 PIRSF : W8FKE7
1 SUPERFAM : W8FKE7
Sequence
Graphical view for this peptide sequence: bacpu-w8fke7
Colored MSA for Lipase_2 (raw)
MKVICFKKKSLQILVALALVIGSMAFIQPKEIKAAEHNPVVMVHGMGGAS
YNFASIKSYLVTQGWDRNQLFAIDFIDKTGNNRNNGPRLSRFVKDVLGKT
GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTLGGANGLVSLRALPG
TDPNQKILYTSVYSSADMIVVNSLSRLIGARNVLIHGVGHISLLASSQVK
GYIKEGLNGGGQNTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVICFKKKSLQILVALALVIGSMAFIQPKEIKAAEHNPVVMVHGMGGAS
YNFASIKSYLVTQGWDRNQLFAIDFIDKTGNNRNNGPRLSRFVKDVLGKT
GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTLGGANGLVSLRALPG
TDPNQKILYTSVYSSADMIVVNSLSRLIGARNVLIHGVGHISLLASSQVK
GYIKEGLNGGGQNTN


References
    Title: Structure and Mechanism of a Cold-Adapted Bacterial Lipase
    van der Ent F, Lund BA, Svalberg L, Purg M, Chukwu G, Widersten M, Isaksen GV, Brandsdal BO, qvist J
    Ref: Biochemistry, :, 2022 : PubMed

            

    Title: ThermoSlope: A Software for Determining Thermodynamic Parameters from Single Steady-State Experiments
    Lund BA, Brandsdal BO
    Ref: Molecules, 26:, 2021 : PubMed

            

    Title: Characterization and a point mutational approach of a psychrophilic lipase from an arctic bacterium, Bacillus pumilus
    Wi AR, Jeon SJ, Kim S, Park HJ, Kim D, Han SJ, Yim JH, Kim HW
    Ref: Biotechnol Lett, 36:1295, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer