Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsp-lip

Geobacillus thermoleovorans Geobacillus zalihae T1 Bacillus sp. 42 organic solvent tolerant lipase, ARA, T1 Lipase GD-95, Antarctic Pseudomonas AMS3 lipase

Comment
Other Strains: (Trembl Q9LAF4 ) Bell P.J.L., Nevalainen H., Morgan H.W. Cloning, sequencing and expression of a new lipase from a thermophilic Bacillus isolate, strain Tp10A.1, (Trembl Q842J9) Thean Chor L., Raja Noor Zaliha R.A.R., Abu Bakar S., Mahiran B. Geobacillus sp. strain T1 thermostable lipase gene, (Trembl Q8L1V2; Q8L1V1) Gaballa A.A., Abdel-Al N.A., Abdel-Fattah Y.R. III.Cloning of a thermophilic lipase from Bacillus thermoleovorans and from Bacillus sp. tosh Geobacillus sp. 95. AMS3 lipase from an Antarctic Pseudomonas


Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|Geobacillus thermoleovorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus thermoleovorans group: N E > Geobacillus thermoleovorans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
9 structures (e.g. : 2DSN, 2Z5G, 3AUK... more)
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bacsp-lip
Colored MSA for Bacterial_lip_FamI.5 (raw)
MKCCRVMFVLLGLWLVFGLSVSGGRAEAAASRANDAPIVLLHGFTGWGRE
EMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVG
GTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTARML
VSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLVN
MVDFTDRFFDLQKAVLEAAAVASNVPYTSQVYDFKLDQWGLRRQPGESFD
HYFERLKRSPVWTSTDTARYDLSVSGAEKLNQWVQASPNTYYLSFATERT
YRGALTGNYYPELGMNAFSAVVCAPFLGSYRNPTLGIDDRWLENDGIVNT
VSMNGPKRGSSDRIVPYDGALKKGVWNDMGTYNVDHLEIIGVDPNPSFDI
RAFYLRLAEQLASLRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKCCRVMFVLLGLWLVFGLSVSGGRAEAAASRANDAPIVLLHGFTGWGRE
EMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVG
GTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTARML
VSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLVN
MVDFTDRFFDLQKAVLEAAAVASNVPYTSQVYDFKLDQWGLRRQPGESFD
HYFERLKRSPVWTSTDTARYDLSVSGAEKLNQWVQASPNTYYLSFATERT
YRGALTGNYYPELGMNAFSAVVCAPFLGSYRNPTLGIDDRWLENDGIVNT
VSMNGPKRGSSDRIVPYDGALKKGVWNDMGTYNVDHLEIIGVDPNPSFDI
RAFYLRLAEQLASLRP


References
25 more
    Title: Structure elucidation and docking analysis of 5M mutant of T1 lipase Geobacillus zalihae
    Ishak SNH, Kamarudin NHA, Ali MSM, Leow ATC, Shariff FM, Rahman RNZRA
    Ref: PLoS ONE, 16:e0251751, 2021 : PubMed

            

    Title: Enhancing the stability of Geobacillus zalihae T1 lipase in organic solvents and insights into the structural stability of its variants
    Maiangwa J, Hamdan SH, Ali MSM, Salleh AB, Rahman RNZRA, Shariff FM, Leow TC
    Ref: J Mol Graph Model, 105:107897, 2021 : PubMed

            

    Title: Ion-Pair Interaction and Hydrogen Bonds as Main Features of Protein Thermostability in Mutated T1 Recombinant Lipase Originating from Geobacillus zalihae
    Ishak SNH, Kamarudin NHA, Ali MSM, Leow ATC, Rahman RNZRA
    Ref: Molecules, 25:3430, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer