bacsu-CAH

 
Bacillus subtilis cephalosporin c deacetylase (EC 3.1.1.41)

Comment
Other strains: Bacillus subtilis (subsp. spizizenii (strain ATCC 23059 / NRRL B-1447 / W23); ATCC 6633; natto BEST195); BSn5 6 aa different in P94388 and Q59233. The structure is identical to P94388 but residues 122 and 315 are Arg and Ile


Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 1L7A, 1ODS, 1ODT
No kinetic



>3 Genbank links 4 more: D50453, Z99105, D10935
2 UniProt : E0U1N4, D4G4X8
3 Structure : 1L7A, 1ODS, 1ODT
>3 UniProtTrembl links 1 more: P94388, Q59233, E0U1N4
>3 Interpro links 1 more: P94388, Q59233, E0U1N4
>3 Prodom links 1 more: P94388, Q59233, E0U1N4
>3 Pfam links 1 more: P94388, Q59233, E0U1N4
>3 PIRSF links 1 more: P94388, Q59233, E0U1N4
>3 SUPERFAM links 1 more: P94388, Q59233, E0U1N4
>3 QuickSwissBlast links 1 more: P94388, Q59233, E0U1N4
 
Sequence
Graphical view for this peptide sequence: bacsu-CAH
Colored MSA for Acetyl-esterase_deacetylase (raw)
MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYP
ADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIH
EMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYY
RGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAA
VADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDI
MNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEY
IPAFQTEKLAFFKQHLKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYP
ADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIH
EMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYY
RGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAA
VADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDI
MNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEY
IPAFQTEKLAFFKQHLKG

no DNA




References
3 more
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: The 25 degrees-36 degrees region of the Bacillus subtilis chromosome: determination of the sequence of a 146 kb segment and identification of 113 genes
    Yamane K, Kumano M, Kurita K
    Ref: Microbiology, 142 ( Pt 11):3047, 1996 : PubMed

            

    Title: Gene cloning, nucleotide sequence, and expression of a cephalosporin-C deacetylase from Bacillus subtilis
    Mitsushima K, Takimoto A, Sonoyama T, Yagi S
    Ref: Applied Environmental Microbiology, 61:2224, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer