Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsu-LIPB

Bacillus subtilis, Bacillus sp., Bacillus megaterium, yfip (esterase) (EC 3.1.1.1) lipW estB lipA lipB lipJ

Comment
Other strains: Bacillus subtilis (strains 168; BSn5; subsp. natto BEST195; subsp. spizizenii (strains: ATCC 6633; ATCC 23059 / NRRL B-14472 / W23)), Bacillus sp. BP-6, Bacillus megaterium Ruiz et al showed that this is an ubiquitous lipase among mesophilic Bacillus species


Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Bacillus subtilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: D78508, Z99108, AJ430985
>3 UniProt links 3 more: Q79F14, P94444, Q8RJP5
>3 UniProt links 3 more: P94444, Q79F14, Q8RJP5
>3 Interpro links 3 more: P94444, Q79F14, Q8RJP5
>3 Prodom links 3 more: P94444, Q79F14, Q8RJP5
>3 Pfam links 3 more: P94444, Q79F14, Q8RJP5
>3 PIRSF links 3 more: P94444, Q79F14, Q8RJP5
>3 SUPERFAM links 3 more: P94444, Q79F14, Q8RJP5
Sequence
Graphical view for this peptide sequence: bacsu-LIPB
Colored MSA for Lipase_2 (raw)
MKKVLMAFIICLSLILSVLAAPPSGAKAESVHNPVVLVHGISGASYNFFA
IKNYLISQGWQSNKLYAIDFYDKTGNNLNNGPQLASYVDRVLKETGAKKV
DIVAHSMGGANTLYYIKYLGGGNKIQNVVTLGGANGLVSSTALPGTDPNQ
KILYTSIYSLNDQIVINSLSRLQGARNIQLYGIGHIGLLSNSQVNGYIKE
GLNGGGLNTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKVLMAFIICLSLILSVLAAPPSGAKAESVHNPVVLVHGISGASYNFFA
IKNYLISQGWQSNKLYAIDFYDKTGNNLNNGPQLASYVDRVLKETGAKKV
DIVAHSMGGANTLYYIKYLGGGNKIQNVVTLGGANGLVSSTALPGTDPNQ
KILYTSIYSLNDQIVINSLSRLQGARNIQLYGIGHIGLLSNSQVNGYIKE
GLNGGGLNTN


References
5 more
    Title: Isolation and characterization of Bacillus sp. BP-6 LipA, a ubiquitous lipase among mesophilic Bacillus species
    Ruiz C, Javier Pastor FI, Diaz P
    Ref: Lett Appl Microbiol, 37:354, 2003 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: The Bacillus subtilis chromosome region near 78 degrees contains the genes encoding a new two-component system, three ABC transporters and a lipase
    Yamamoto H, Uchiyama S, Sekiguchi J
    Ref: Gene, 181:147, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer