bacsu-YBAC

 
Bacillus subtilis, Bacillus sp. hypothetical 36.9 kda protein

Comment
Other strains: Bacillus subtilis (strains 168; BSn5; QB928; BEST7613; MB73/2; BEST7003; PY79; QH-1; subsp. subtilis (SC-8; RO-NN-1; BSP1; 6051-HGW); subsp. natto (strain BEST195), Bacillus sp. EGD-AK10


Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 12 more: D64127, Z99104, AP011541
2 UniProt : D4G3K2, G4F0S4
3 UniProtTrembl : P70981, D4G3K2, G4F0S4
3 Interpro : P70981, D4G3K2, G4F0S4
3 Prodom : P70981, D4G3K2, G4F0S4
3 Pfam : P70981, D4G3K2, G4F0S4
3 PIRSF : P70981, D4G3K2, G4F0S4
3 SUPERFAM : P70981, D4G3K2, G4F0S4
3 QuickSwissBlast : P70981, D4G3K2, G4F0S4
 
Sequence
Graphical view for this peptide sequence: bacsu-YBAC
Colored MSA for Proline_iminopeptidase (raw)
MIPEKKSIAIMKELSIGNTKQMLMINGVDVKNPLLLFLHGGPGTPQIGYV
RHYQKELEQYFTVVHWDQRGSGLSYSKRISHHSMTINHFIKDTIQVTQWL
LAHFSKSKLYLAGHSWGSILALHVLQQRPDLFYTYYGISQVVNPQDEEST
AYQHIREISESKKASILSFLTRFIGAPPWKQDIQHLIYRFCVELTRGGFT
HRHRQSLAVLFQMLTGNEYGVRNMHSFLNGLRFSKKHLTDELYRFNAFTS
VPSIKVPCVFISGKHDLIVPAEISKQYYQELEAPEKRWFQFENSAHTPHI
EEPSLFANTLSRHARNHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIPEKKSIAIMKELSIGNTKQMLMINGVDVKNPLLLFLHGGPGTPQIGYV
RHYQKELEQYFTVVHWDQRGSGLSYSKRISHHSMTINHFIKDTIQVTQWL
LAHFSKSKLYLAGHSWGSILALHVLQQRPDLFYTYYGISQVVNPQDEEST
AYQHIREISESKKASILSFLTRFIGAPPWKQDIQHLIYRFCVELTRGGFT
HRHRQSLAVLFQMLTGNEYGVRNMHSFLNGLRFSKKHLTDELYRFNAFTS
VPSIKVPCVFISGKHDLIVPAEISKQYYQELEAPEKRWFQFENSAHTPHI
EEPSLFANTLSRHARNHL

no DNA




References
10 more
    Title: Whole genome assembly of a natto production strain Bacillus subtilis natto from very short read data
    Nishito Y, Osana Y, Hachiya T, Popendorf K, Toyoda A, Fujiyama A, Itaya M, Sakakibara Y
    Ref: BMC Genomics, 11:243, 2010 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Sequence analysis of a 50 kb region between spo0H and rrnH on the Bacillus subtilis chromosome
    Yasumoto K, Liu H, Jeong SM, Ohashi Y, Kakinuma S, Tanaka K, Kawamura F, Yoshikawa H, Takahashi H
    Ref: Microbiology, 142 ( Pt 11):3039, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer