bacsu-YDEN

 
Bacillus subtilis yden protein

Comment
Other strains: Bacillus subtilis (strains 168; subsp. natto BEST195; BSn5)


Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1UXO: The Crystal Structure Of The Yden Gene Product From B. Subtilis
No kinetic



2 Genbank : AB001488, Z99106
2 UniProt : P96671, D4G5M3
1 Structure : 1UXO
2 UniProtTrembl : P96671, D4G5M3
2 Interpro : P96671, D4G5M3
2 Prodom : P96671, D4G5M3
2 Pfam : P96671, D4G5M3
2 PIRSF : P96671, D4G5M3
2 SUPERFAM : P96671, D4G5M3
2 QuickSwissBlast : P96671, D4G5M3
 
Sequence
Graphical view for this peptide sequence: bacsu-YDEN
Colored MSA for Hydrolase_RBBP9_YdeN (raw)
MTKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDW
LDTLSLYQHTLHENTYLVAHSLGCPAILRFLEHLQLRKQLGGIILVSGFA
KSLPTLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQ
QIDAALYEVQHGGHFLEDEGFTSLPIVYDVLTSYFSKETR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDW
LDTLSLYQHTLHENTYLVAHSLGCPAILRFLEHLQLRKQLGGIILVSGFA
KSLPTLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQ
QIDAALYEVQHGGHFLEDEGFTSLPIVYDVLTSYFSKETR

no DNA




References
2 more
    Title: Complete genome sequence of Bacillus subtilis BSn5, an endophytic bacterium of Amorphophallus konjac with antimicrobial activity for the plant pathogen Erwinia carotovora subsp. carotovora
    Deng Y, Zhu Y, Wang P, Zhu L, Zheng J, Li R, Ruan L, Peng D, Sun M
    Ref: Journal of Bacteriology, 193:2070, 2011 : PubMed

            

    Title: Whole genome assembly of a natto production strain Bacillus subtilis natto from very short read data
    Nishito Y, Osana Y, Hachiya T, Popendorf K, Toyoda A, Fujiyama A, Itaya M, Sakakibara Y
    Ref: BMC Genomics, 11:243, 2010 : PubMed

            

    Title: Harvesting the high-hanging fruit: the structure of the YdeN gene product from Bacillus subtilis at 1.8 angstroms resolution
    Janda I, Devedjiev Y, Cooper D, Chruszcz M, Derewenda U, Gabrys A, Minor W, Joachimiak A, Derewenda ZS
    Ref: Acta Crystallographica D Biol Crystallogr, 60:1101, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer