bacsu-YITV

 
Bacillus subtilis hypothetical protein yitv

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: Z79580, Y09476, Z99109
1 UniProt : A0A1B2BII0
2 UniProtTrembl : P70948, A0A1B2BII0
2 Interpro : P70948, A0A1B2BII0
2 Prodom : P70948, A0A1B2BII0
2 Pfam : P70948, A0A1B2BII0
2 PIRSF : P70948, A0A1B2BII0
2 SUPERFAM : P70948, A0A1B2BII0
2 QuickSwissBlast : P70948, A0A1B2BII0
 
Sequence
Graphical view for this peptide sequence: bacsu-YITV
Colored MSA for 5_AlphaBeta_hydrolase (raw)
MIQIENQTVSGIPFLHIVKEENRHRAVPLVIFIHGFTSAKEHNLHIAYLL
AEKGFRAVLPEALHHGERGEEMAVEELAGHFWDIVLNEIEEIGVLKNHFE
KEGLIDGGRIGLAGTSMGGITTLGALTAYDWIKAGVSLMGSPNYVELFQQ
QIDHIQSQGIEIDVPEEKVQQLMKRLELRDLSLQPEKLQQRPLLFWHGAK
DKVVPYAPTRKFYDTIKSHYSEQPERLQFIGDENADHKVPRAAVLKTIEW
FETYL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIQIENQTVSGIPFLHIVKEENRHRAVPLVIFIHGFTSAKEHNLHIAYLL
AEKGFRAVLPEALHHGERGEEMAVEELAGHFWDIVLNEIEEIGVLKNHFE
KEGLIDGGRIGLAGTSMGGITTLGALTAYDWIKAGVSLMGSPNYVELFQQ
QIDHIQSQGIEIDVPEEKVQQLMKRLELRDLSLQPEKLQQRPLLFWHGAK
DKVVPYAPTRKFYDTIKSHYSEQPERLQFIGDENADHKVPRAAVLKTIEW
FETYL

no DNA




References
1 more
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: A 10.3 kbp segment from nprB to argJ at the 102 degrees region of the Bacillus subtilis chromosome
    Levine A, Vannier F, Roche B, Autret S, Mavel D, Seror SJ
    Ref: Microbiology, 143 ( Pt 1):175, 1997 : PubMed

            

    Title: Sequencing of regions downstream of addA (98 degrees) and citG (289 degrees) in Bacillus subtilis
    Medina N, Vannier F, Roche B, Autret S, Levine A, Seror SJ
    Ref: Microbiology, 143 ( Pt 10):3305, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer