bacsu-YvaM

specifically binds to promoter sequences of rapG and rapH. rapG and rapH are inhibitors of srfA expression

5_AlphaBeta_hydrolase : bacsu-YITVBacillus subtilis hypothetical protein yitv.
6_AlphaBeta_hydrolase : bacsu-cbxnp Bacillus subtilis carboxylesterase NA ou NP naproxen ester hydrolase CesA P96688, bacsu-ybfk Bacillus subtilis ybkf CesB, bacsu-yqjlBacillus subtilis hypothetical protein yqjl, baciu-a0a0d5d3y1Bacillus subtilis. Uncharacterized protein.
A85-IroE-IroD-Fes-Yiel : bacsu-YJCHBacillus subtilis yjch (and subsp. natto BEST195) protein, bacsu-YUIIBacillus subtilis (and subsp. natto BEST195) YUII protein.
Abhydrolase_7 : bacsu-YTAPBacillus subtilis ytap.
Acetyl-esterase_deacetylase : bacsu-CAH Bacillus subtilis cephalosporin c deacetylase (EC 3.1.1.41).
ACPH_Peptidase_S9 : bacsu-YTMABacillus subtilis putative peptidase, bacsu-yuxlBacillus subtilis probable peptidase yuxl (EC 3.4.21.-).
AlphaBeta_hydrolase : bacsu-YBDGBacillus subtilis ybdg protein, bacsu-ycgSBacillus subtilis gene ycgS, bacsu-yclEBacillus subtilis yclE BAA08999.1, bacsu-yqkdBacillus subtilis hypothetical protein yqkd, bacsu-YRAKBacillus subtilis hypothetical protein yrak.
Bacillus_lip : bacsu-yjauBacillus subtilis. hypothetical protein yjau.
CarbLipBact_1 : bacsu-YVAKBacillus subtilis, Bacillus amyloliquefaciens, Bacillus atrophaeus, Bacillus subtilis, YvaK protein Carboxylesterase.
Carbon-carbon_bond_hydrolase : bacsu-yugFBacillus subtilis gene yugF.
Carb_B_Bacteria : bacsu-pnbae Bacillus subtilis, Bacillus sp., EH84 para-nitrobenzyl esterase (pnbA) intracellular esterase B CarEW, bacsu-q4pns3Bacillus subtilis RRL-BB1. carboxylesterase, baciu-a0a0f0a5r4Bacillus subtilis; Bacillus licheniformis; Bacillus cereus. Carboxylic ester hydrolase.
Dienelactone_hydrolase : bacsu-yczhBacillus subtilis hypothetical 21.1 kda protein in sipu-kipi intergenic region.
Epoxide_hydrolase : bacsu-yfhMBacillus subtilis (and subsp. natto BEST195) yfhM Epoxide_hydrolase like Bsueh.
Haloperoxidase : bacsu-ydjpBacillus subtilis BAA22772.1 (and subsp. natto BEST195) peroxydase, bacsu-yisYBacillus subtilis (and subsp. natto BEST195) yisY Haloperoxidase like.
Hormone-sensitive_lipase_like : bacsu-brefe Bacillus subtilis brefeldin A esterase.
Hydrolase_RBBP9_YdeN : bacsu-YDEN Bacillus subtilis yden protein.
Lipase_2 : bacsu-lip Bacillus subtilis lipase (lipA) (EC 3.1.1.3) BSLA (triacylglycerol lipase), bacsu-LIPBBacillus subtilis, Bacillus sp., Bacillus megaterium, yfip (esterase) (EC 3.1.1.1) lipW estB lipA lipB lipJ.
LYsophospholipase_carboxylesterase : bacsu-MHQDBacillus subtilis yolf.
MenH_SHCHC : bacsu-ytxmBacillus subtilis, Bacillus sp. ytxm.
Monoglyceridelipase_lysophospholip : bacsu-YTPABacillus subtilis Bacilysocin biosynthesis protein ytpA.
Proline_iminopeptidase : bacsu-YBACBacillus subtilis, Bacillus sp. hypothetical 36.9 kda protein.
RsbQ-like : bacsu-yvfQ Bacillus subtilis yvfQ sigma factor sigb CAB08011.1 CAB15415.1 also regulation proteinRsbQ.
Thioesterase : bacsu-FENB Bacillus subtilis; Bacillus malacitensis; Bacillus [Brevibacterium] halotolerans fengycin synthetase, bacsu-ITUCBacillus subtilis; Bacillus amyloliquefaciens; Bacillus sp., Iturin a synthetase c, bacsu-MYCCBacillus subtilis mycc Mycosubtilin synthase subunit C Thioesterase domain, bacsu-PKSRBacillus subtilis polyketide synthase Thioesterase domain, bacsu-PPSEBacillus subtilis peptide synthetase orf5 Thioesterase domain, bacsu-q6yk39Bacillus subtilis Bacillus amyloliquefaciens; Bacillus velezensis; Mycobacterium abscessus; Bacillus sp., bacillomycin d synthetase c, bacsu-srf4 Bacillus subtilis csi16 Thioesterase domain, bacsu-srfac Bacillus subtilis surfactin synthetase subunit 3, bacsu-SRFCBacillus subtilis and Bacillus amyloliquefaciens putative surfactin synthetase (fragment), bacsu-SRFDBacillus subtilis, Bacillus sp. CY22, Bacillus amyloliquefaciens, srfD srfDB3 srfad putative thioesterase, bacsu-YUKLBacillus subtilis DHBF yukl protein yukk protein Thioesterase domain dimodular nonribosomal peptide synthetase

MPLISIDSRKHLFYEEYGQGIPIIFIHPPGMGRKVFYYQRLLSKHFRVIF
PDLSGHGDSDHIDQPASISYYANEIAQFMDALHIDKAVLFGYSAGGLIAQ
HIGFTRPDKVSHLILSGAYPAVHNVIGQKLHKLGMYLLEKNPGLLMKILA
GSHTKDRQLRSILTDHMKKADQAHWHQYYLDSLGYNCIEQLPRLEMPMLF
MYGGLRDWTFTNAGYYRRSCRHAEFFRLEYQGHQLPTKQWKTCNELVTGF
VLTHHS

Title: Bacillus subtilis RghR (YvaN) represses rapG and rapH, which encode inhibitors of expression of the srfA operon
Hayashi K, Kensuke T, Kobayashi K, Ogasawara N, Ogura M
Ref: Molecular Microbiology, 59:1714, 2006 : PubMed
Abstract


ESTHER: Hayashi_2006_Mol.Microbiol_59_1714
PubMedSearch: Hayashi 2006 Mol.Microbiol 59 1714
PubMedID: 16553878
Gene_locus related to this paper: bacsu-YvaM

Abstract

Rap proteins regulate the activity of response regulators including Spo0F, DegU and ComA. We found that overexpression of either RapG or RapH severely downregulated the expression of srfA, which belongs to the ComA regulon. Disruption of those genes, however, showed small effects on srfA expression. These observations suggested that Bacillus subtilis cells possess a repressor for rapG and rapH. To identify candidate repressors we developed a novel transcription factor array (TF array) assay, in which disruptions of 287 genes encoding regulatory proteins were independently transformed into a strain carrying rapH-lacZ and the resultant transformants were grown on agar plates containing Xgal to detect beta-galactosidase activity. We identified a yvaN disruptant which showed a rapH-overproducing phenotype. DNA microarray analysis of the yvaN mutant suggested that both rapG and rapH were overproduced, leading to inhibition of srfA expression. In a gel retardation assay, purified His-tagged YvaN specifically bound to promoter sequences of rapG and rapH. Further footprint and gel retardation analyses using various deleted probes uncovered critical sequences for YvaN binding. In addition, a lacZ fusion analysis confirmed the significance of YvaN binding for transcription regulation of rapG and rapH. Thus, YvaN was renamed RghR (rapG and rapH repressor). As the rapH gene is activated by ComK and RapH inhibits comK indirectly, this constitutes an autoregulatory loop modulated by RghR.



        

Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)> Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A (- 140)
Ref: Nature, 390:249, 1997 : PubMed
Abstract


ESTHER: Kunst_1997_Nature_390_249
PubMedSearch: Kunst 1997 Nature 390 249
PubMedID: 9384377
Gene_locus related to this paper: bacsu-CAH, bacsu-cbxnp, bacsu-lip, bacsu-LIPB, bacsu-PKSR, bacsu-pnbae, bacsu-PPSE, bacsu-srf4, bacsu-srfac, bacsu-YBAC, bacsu-YBDG, bacsu-ybfk, bacsu-ycgS, bacsu-yczh, bacsu-YDEN, bacsu-ydjp, bacsu-yfhM, bacsu-yisY, bacsu-YITV, bacsu-yjau, bacsu-YJCH, bacsu-MHQD, bacsu-yqjl, bacsu-yqkd, bacsu-YRAK, bacsu-YTAP, bacsu-YTMA, bacsu-YTPA, bacsu-ytxm, bacsu-yugF, bacsu-YUII, bacsu-YUKL, bacsu-YVAK, bacsu-YvaM, bacsu-yvfQ

Abstract

Bacillus subtilis is the best-characterized member of the Gram-positive bacteria. Its genome of 4,214,810 base pairs comprises 4,100 protein-coding genes. Of these protein-coding genes, 53% are represented once, while a quarter of the genome corresponds to several gene families that have been greatly expanded by gene duplication, the largest family containing 77 putative ATP-binding transport proteins. In addition, a large proportion of the genetic capacity is devoted to the utilization of a variety of carbon sources, including many plant-derived molecules. The identification of five signal peptidase genes, as well as several genes for components of the secretion apparatus, is important given the capacity of Bacillus strains to secrete large amounts of industrially important enzymes. Many of the genes are involved in the synthesis of secondary metabolites, including antibiotics, that are more typically associated with Streptomyces species. The genome contains at least ten prophages or remnants of prophages, indicating that bacteriophage infection has played an important evolutionary role in horizontal gene transfer, in particular in the propagation of bacterial pathogenesis.